Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KREGLIR2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 203 -
GLIRARL2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 206 -
FLDSHCE2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 225
  • Metal Site D=Aspartic acid at location 227 on the protein
  • Metal Site Description: Manganese (By similarity).
  • Binding Site D=Aspartic acid at location 227 on the protein
  • Binding site description: Substrate (By similarity).
PCSRVGH2.4.1.41;Polypeptide N-acetylgalactosaminyltransferase. 354 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRNAIIQGLFYGSLTFGIWTALLFIYLHHNHVSSWQKKSQEPLSAWSPGKKVHQQIIYGSEQIPKPHVIVKRTDEDKAKSMLGTDFNHTNPELHKELLKY
GFNVIISRSLGIEREVPDTRSKMCLQKHYPARLPTASIVICFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKLDYHLETFRGKVKIIR
NK
KREGLIRARLIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTK
PIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQLFII
PCSRVGHISKKQTGKPSTIISAMTHNYLRLVHVWLDEYKEQFFLRKP
GLKYVTYGNIRERVELRKRLGCKSFQWYLDNVFPELEASVNSL



DME EC Prediction for this protein is: 2.4.1.41
Check another protein