Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RLEIVFVSSD1.8.1.8;Protein-disulfide reductase. 85
  • Gene: NXN
DMPWLALPY1.8.1.8;Protein-disulfide reductase. 106
  • Gene: NXN
EKHRKLKLWNK1.8.1.8;Protein-disulfide reductase. 116
  • Gene: NXN
VCRNGLL1.8.1.8;Protein-disulfide reductase. 146
  • Gene: NXN
GLEFPWGPKPF1.8.1.8;Protein-disulfide reductase. 160
  • Gene: NXN
EVIAGPL1.8.1.8;Protein-disulfide reductase. 172
  • Domain: Thioredoxin
  • Gene: NXN
VGVYFSAHWCPPCRSLTRVLVESYRK1.8.1.8;Protein-disulfide reductase. 196
  • Domain: Thioredoxin
  • Gene: NXN
QYFSEMPWLAVPY1.8.1.8;Protein-disulfide reductase. 245
  • Domain: Thioredoxin
  • Gene: NXN
DEARRSRLNRLYGIQGIP1.8.1.8;Protein-disulfide reductase. 259
  • Domain: Thioredoxin
  • Gene: NXN
GEVITRQGRVEVL1.8.1.8;Protein-disulfide reductase. 285
  • Domain: Thioredoxin
  • Gene: NXN
EGPCLVLFVD1.8.1.8;Protein-disulfide reductase. 325
  • Gene: NXN
GESEAAKQLIQPIAEKIIA1.8.1.8;Protein-disulfide reductase. 339
  • Gene: NXN
PLLFFVAGEDDM1.8.1.8;Protein-disulfide reductase. 367
  • Gene: NXN
DSLRDYTNLPEAAPLLTILDMSARAKYV1.8.1.8;Protein-disulfide reductase. 380
  • Gene: NXN

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGPGAGAGAAAEPEPRRRLEIVFVSSDQDQRQW
QDFVR
DMPWLALPYKEKHRKLKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYF
SAHWCPPCRSLTRVLVESYRK
IKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDE
DCREFPWHPKPVLELSDSNAAQLN
EGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDM
SARAKYV
MDVEEITPAIVEAFVNDFLAEKLKPEPI



DME EC Prediction for this protein is: 1.8.1.8
Check another protein