Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
HLNPSLLQNVELDPEGV3.1.13.4;Poly(A)-specific ribonuclease. 28
  • Gene: PAN2
HGGHATSFFGP3.1.13.4;Poly(A)-specific ribonuclease. 93
  • Gene: PAN2
LERYSSFQVN3.1.13.4;Poly(A)-specific ribonuclease. 105
  • Gene: PAN2
RGGLIIFDYL3.1.13.4;Poly(A)-specific ribonuclease. 142
  • Gene: PAN2
EIDLNTVQETQKY3.1.13.4;Poly(A)-specific ribonuclease. 180
  • Gene: PAN2
VEHEFDA3.1.13.4;Poly(A)-specific ribonuclease. 228
  • Gene: PAN2
SGSLSDFDVHGNLL3.1.13.4;Poly(A)-specific ribonuclease. 236
  • Gene: PAN2
GLACDRFLKVYDLRMMRA3.1.13.4;Poly(A)-specific ribonuclease. 260
  • Gene: PAN2
FLRFIPTYTSRLAIISQ3.1.13.4;Poly(A)-specific ribonuclease. 289
  • Gene: PAN2
GQCQFCEPTGLANPADIFHVN3.1.13.4;Poly(A)-specific ribonuclease. 307
  • Gene: PAN2
MTFDVSASKQALAFGDSEGCVHLW3.1.13.4;Poly(A)-specific ribonuclease. 334
  • Gene: PAN2
PLSLIPVPLT3.1.13.4;Poly(A)-specific ribonuclease. 394
  • Gene: PAN2
EILRTMKKVGFIGYAPNPRT3.1.13.4;Poly(A)-specific ribonuclease. 429
  • Gene: PAN2
LRNQIPYRLKE3.1.13.4;Poly(A)-specific ribonuclease. 450
  • Gene: PAN2
KKYRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPNAYC3.1.13.4;Poly(A)-specific ribonuclease. 489
  • Gene: PAN2
QNHLCQKEFCL3.1.13.4;Poly(A)-specific ribonuclease. 546
  • Gene: PAN2
WNRFILTQLHQ3.1.13.4;Poly(A)-specific ribonuclease. 616
  • Gene: PAN2
PQAYRGAG3.1.13.4;Poly(A)-specific ribonuclease. 634
  • Gene: PAN2
LVINCEVNSSKEADFW3.1.13.4;Poly(A)-specific ribonuclease. 741
  • Gene: PAN2
VYVYDLMATVVHILDSRTGGSLV3.1.13.4;Poly(A)-specific ribonuclease. 847
  • Gene: PAN2
HIKVGETYHQRKEGVTHQQWYLFNDFLIEP3.1.13.4;Poly(A)-specific ribonuclease. 871
  • Gene: PAN2
EAVQFDM3.1.13.4;Poly(A)-specific ribonuclease. 905
  • Gene: PAN2
WKVPAILYY3.1.13.4;Poly(A)-specific ribonuclease. 913
  • Gene: PAN2
TFIPLML3.1.13.4;Poly(A)-specific ribonuclease. 959
  • Gene: PAN2
RSDGTKSTIKPS3.1.13.4;Poly(A)-specific ribonuclease. 992
  • Domain: Exonuclease
  • Gene: PAN2
EQVVDYLT3.1.13.4;Poly(A)-specific ribonuclease. 1033
  • Domain: Exonuclease
  • Gene: PAN2
GVKFVGHGLQKDFRVINLMVPKDQV3.1.13.4;Poly(A)-specific ribonuclease. 1076
  • Domain: Exonuclease
  • Gene: PAN2
HDSIEDA3.1.13.4;Poly(A)-specific ribonuclease. 1134
  • Domain: Exonuclease
  • Gene: PAN2
IEDARTAL3.1.13.4;Poly(A)-specific ribonuclease. 1137
  • Domain: Exonuclease
DWKVPEP3.1.13.4;Poly(A)-specific ribonuclease. 1178
  • Gene: PAN2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MNFEGLDPGLAEYAPAMHSALDPVLDAHLNPSLLQNVELDPEGVALEALPVQESVHIMEGVYSELHSVVAEVGVPVSVSHFDLHEEMLWVGSHGGHATSF
FGP
ALERYSSFQVNGSDDIRQIQSLENGILFLTKNNLKYMARGGLIIFDYLLDENEDMHSLLLTDSSTLLVGGLQNHIIEIDLNTVQETQKYAVETPGVT
IMRQTNRFFFCGHTSGKVSLRDLRTFK
VEHEFDAFSGSLSDFDVHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITPLQVHVDPAFLRFIPTYTSRL
AIISQ
SGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDSEGCVHLWTDSPEPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIPV
PLT
TDTLLSDWPAANSAPAPRRAPPVDAEILRTMKKVGFIGYAPNPRTRLRNQIPYRLKESDSEFDSFSQVTESPVGREEEPHLHMVSKKYRKVTIKYSK
LGLEDFDFKHYNKTLFAGLEPHIPNAYC
NCMIQVLYFLEPVRCLIQNHLCQKEFCLACELGFLFHMLDLSRGDPCQGNNFLRAFRTIPEASALGLILADS
DEASGKGNLARLIQR
WNRFILTQLHQDMQELEIPQAYRGAGGSSFCSSGDSVIGQLFSCEMENCSLCRCGSETVRASSTLLFTLSYPDGSKSDKTGKNYD
FAQVLKRSICLDQNTQAWCDTCEKYQPTIQTRNIRHLPDI
LVINCEVNSSKEADFWRMQAEVAFKMAVKKHGGEISKNKEFALADWKELGSPEGVLVCPS
IEELKNVWLPFSIRMKMTKNKGLDVCNWTDGDEMQWGPARAEEEHG
VYVYDLMATVVHILDSRTGGSLVAHIKVGETYHQRKEGVTHQQWYLFNDFLIEP
IDKHEAVQFDMNWKVPAILYYVKRNLNSRYNLNIKNPIEASVLLAEASLARKQRKTHTTFIPLMLNEMPQIGDLVGLDAEFVTLNEEEAELRSDGTKSTI
KPS
QMSVARITCVRGQGPNEGIPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKISSKHLTTLKSTYLKLRFLIDIGVKFVGHGLQKDFRVINLMVPKDQV
LDTVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVL
AL



DME EC Prediction for this protein is: 3.1.13.4
Check another protein