Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
HGSIIYHPS1.5.1.6;Formyltetrahydrofolate dehydrogenase. 122
  • Active Site H=Histidine at location 128 on the protein
  • Active Site Description: Proton donor (By similarity).
LPRHRGASAINWTL1.5.1.6;Formyltetrahydrofolate dehydrogenase. 132 -
FWADDGLDTG1.5.1.6;Formyltetrahydrofolate dehydrogenase. 157 -
YNRFLFPEG1.5.1.6;Formyltetrahydrofolate dehydrogenase. 186 -
EDSTDFFK1.5.1.6;Formyltetrahydrofolate dehydrogenase. 363
  • Domain: Acyl carrier
NEDVYMA1.5.1.6;Formyltetrahydrofolate dehydrogenase. 396
  • Domain: Acyl carrier
TINPTDG1.5.1.6;Formyltetrahydrofolate dehydrogenase. 462 -
GAVYTLALKTH1.5.1.6;Formyltetrahydrofolate dehydrogenase. 533 -
TIPINQARPNRNLT1.5.1.6;Formyltetrahydrofolate dehydrogenase. 565 -
IPWNYPLMML1.5.1.6;Formyltetrahydrofolate dehydrogenase. 592 -
AACLAAGNT1.5.1.6;Formyltetrahydrofolate dehydrogenase. 606 -
KPAQVTPLTALKFAEL1.5.1.6;Formyltetrahydrofolate dehydrogenase. 618 -
NTYNKTDVAAPFGG1.5.1.6;Formyltetrahydrofolate dehydrogenase. 882 -
KQSGFGKDLGE1.5.1.6;Formyltetrahydrofolate dehydrogenase. 897 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGKADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGA
ELNVLPFCTQFIPMDIIDSPK
HGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPNDTVDALYNRFLFPEGIKAMVE
AVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAEVLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPII
EDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVY
MA
TKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLADVDKAVAAAKDAFENGEWGR
MNARERGRLMYRLADLLEENQEELATIEALDS
GAVYTLALKTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
L
AWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSEHPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSP
LIIFNDCELDKAVRMGMGAVFFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCETGVKEGATLVYGGRQV
QRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGDIDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFI
NTYNKTDVAAPFGGVKQSG
FGKDLGE
EALNEYLKTKTVTLEY



DME EC Prediction for this protein is: 1.5.1.6
Check another protein