Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GWKLTLV3.6.3.44;Xenobiotic-transporting ATPase. 203
  • Domain: ABC transmembrane ty
NGSGKST3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 423
  • Domain: ABC transporter
VSQEPVLF3.6.3.44;Xenobiotic-transporting ATPase. 467
  • Domain: ABC transporter
QRIAIARA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 531
  • Domain: ABC transporter
LVRNPKIL3.6.3.44;Xenobiotic-transporting ATPase. 539
  • Domain: ABC transporter
PKILILDE3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 543
  • Domain: ABC transporter
AHRLSTI3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 580
  • Domain: ABC transporter
QLSGGQKQR3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1155
  • Domain: ABC transporter
KILLLDE3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1175
  • Domain: ABC transporter
LLLDEATSALD3.6.3.44;Xenobiotic-transporting ATPase. 1177
  • Domain: ABC transporter

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MENSERAEEMQENYQRNGTAEEQPKLRKEAVGSIEIFRFADGLDITLMILGILASLVNGACLPLMPLVLGEMSDNLISGCLVQTNTTNYQNCTQSQEKLN
EDMTLLTLYYVGIGVAALIFGYIQISLWIITAARQTKRIRKQFFHSVLAQDIGWFDSCDIGELNTRMTDDIDKISDGIGDKIALLFQNMSTFSIGLAVGL
VK
GWKLTLVTLSTSPLIMASAAACSRMVISLTSKELSAYSKAGAVAEEVLSSIRTVIAFRAQEKELQRYTQNLKDAKDFGIKRTIASKVSLGAVYFFMNG
TYGLAFWYGTSLILNGEPGYTIGTVLAVFFSVIHSSYCIGAAVPHFETFAIARGAAFHIFQVIDKKPSIDNFSTAGYKPESIEGTVEFKNVSFNYPSRPS
IKILKGLNLRIKSGETVALVGL
NGSGKSTVVQLLQRLYDPDDGFIMVDENDIRALNVRHYRDHIGVVSQEPVLFGTTISNNIKYGRDDVTDEEMERAARE
ANAYDFIMEFPNKFNTLVGEKGAQMSGGQK
QRIAIARALVRNPKILILDEATSALDSESKSAVQAALEKASKGRTTIVVAHRLSTIRSADLIVTLKDGML
AEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLLKILKLNKPEWPFVVLGTLASV
LNGTVHPVFSIIFAKIITMFGNNDKTTLKHDAEIYSMIFVILGVICFVSYFMQGLFYGRAGEILTMRLRHLAFKAMLYQDIAWFDEKENSTGGLTTILAI
DIAQIQGATGSRIGVLTQNATNMGLSVIISFIYGWEMTFLILSIAPVLAVTGMIETAAMTGFANKDKQELKHAGKIATEALENIRTIVSLTREKAFEQMY
EEMLQTQHRNTSKKAQIIGSCYAFSHAFIYFAYAAGFRFGAYLIQAGRMTPEGMFIVFTAIAYGAMAIGETLVLAPEYSKAKSGAAHLFALLEKKPNIDS
RSQEGKKPDTCEGNLEFREVSFFYPCRPDVFILRGLSLSIERGKTVAFVGSSGCGKSTSVQLLQRLYDPVQGQVLFDGVDAKELNVQWLRSQIAIVPQEP
VLFNCSIAENIAYGDNSRVVPLDEIKEAANAANIHSFIEGLPEKYNTQVGLKGA
QLSGGQKQRLAIARALLQKPKILLLDEATSALDNDSEKVVQHALDK
ARTGRTCLVVTHRLSAIQNADLIVVLHNGKIKEQGTHQELLRNRDIYFKLVNAQSVQ



DME EC Prediction for this protein is: 3.6.3.44
Check another protein