Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LAEGGFA2.7.11.1;Non-specific serine/threonine protein kinase. 52
  • Domain: Protein kinase
VWEVLILM2.7.11.1;Non-specific serine/threonine protein kinase. 119
  • Domain: Protein kinase
MNQRLQT2.7.11.1;Non-specific serine/threonine protein kinase. 138
  • Domain: Protein kinase
EVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILL2.7.11.1;Non-specific serine/threonine protein kinase. 150
  • Active Site D=Aspartic acid at location 176 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
YVLCDFGSATNKF2.7.11.1;Non-specific serine/threonine protein kinase. 190
  • Domain: Protein kinase
EIKKYTTLSYRAPEM2.7.11.1;Non-specific serine/threonine protein kinase. 216
  • Domain: Protein kinase
DIWALGCLLYKL2.7.11.1;Non-specific serine/threonine protein kinase. 244
  • Domain: Protein kinase
FTLPFGESQVAICDG2.7.11.1;Non-specific serine/threonine protein kinase. 258
  • Domain: Protein kinase
FTIPDNSRYS2.7.11.1;Non-specific serine/threonine protein kinase. 274
  • Domain: Protein kinase
TETSIAPRQRPKA2.7.11.1;Non-specific serine/threonine protein kinase. 360 -
DNFSKLT2.7.11.1;Non-specific serine/threonine protein kinase. 701 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGH
KNIVGYIDSSINNVSSGD
VWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATN
KF
QNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDK
RPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPT
TETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPP
QAAGSSNQPGLLASVPQPKPQAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPPAQQQPAGTFYQQQQAQTQQF
QAVHPATQKPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQQQQQQQLATALHQQQLMTQQAALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQ
PKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAAAEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDD
DNFSKLTAEELLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFIPLQVPDAPEKLIEGLKSPDT
SLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPVPQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNL
ISGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLIDL



DME EC Prediction for this protein is: 2.7.11.1
Check another protein