Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EELTAVM1.4.3;With oxygen as acceptor. 66 -
LVDAAQARPSDNC1.4.3;With oxygen as acceptor. 83 -
FSVELQLP1.4.3;With oxygen as acceptor. 97 -
PPPAREALAI1.4.3;With oxygen as acceptor. 118 -
ELVVGPLP1.4.3;With oxygen as acceptor. 140 -
EYLDIDQMIF1.4.3.21;Primary-amine oxidase. 175 -
MTTAPRGLQSGDRATWFG1.4.3.21;Primary-amine oxidase. 211
  • Gene: AOC3
YEISLQEA1.4.3.21;Primary-amine oxidase. 361 -
GLENWVWAEDM1.4.3.21;Primary-amine oxidase. 534 -
QRLQVTRK1.4.3.21;Primary-amine oxidase. 560 -
PRYLYLA1.4.3;With oxygen as acceptor. 584 -
EPSSSSVFNQNDPW1.4.3.21;Primary-amine oxidase. 641 -
DLVAWVT1.4.3;With oxygen as acceptor. 673
  • Metal Site D=Aspartic acid at location 673 on the protein
  • Metal Site Description: Calcium 1 (By similarity).
DLVAWVTAGFLHIPHAEDIPNTVT1.4.3.21;Primary-amine oxidase. 673
  • Metal Site D=Aspartic acid at location 673 on the protein
  • Metal Site Description: Calcium 1 (By similarity).
FLHIPHAEDIPNTVT1.4.3;With oxygen as acceptor. 682
  • Metal Site H=Histidine at location 684 on the protein
  • Metal Site Description: Copper (By similarity).
SADSIYF1.4.3.21;Primary-amine oxidase. 719 -
PAFSHGGF1.4.3.21;Primary-amine oxidase. 753
  • Gene: AOC3

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MNQKTILVLLILAVITIFALVCVLLVGRGGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVE
LQLP
PKAAALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHCCF
YKHRGRNLVT
MTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSW
SLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLV
YEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTR
GVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFL
FGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVA
GLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHP
RGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEE
EPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNG
VGFFLRPYNFFDEDPSFY
SADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN



DME EC Prediction for this protein is: 1.4.3.21
Check another protein