Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ISCVAEN2.7.10.1;Receptor protein-tyrosine kinase. 264
  • Domain: Ig-like C2-type
  • Gene: NTRK2
HHWCIPF2.7.10.1;Receptor protein-tyrosine kinase. 299
  • Domain: Ig-like C2-type
YICTKIHV2.7.10.1;Receptor protein-tyrosine kinase. 329
  • Domain: Ig-like C2-type
  • Gene: NTRK2
EYHGCLQLDNPTH2.7.10.1;Receptor protein-tyrosine kinase. 341
  • Domain: Ig-like C2-type
  • Gene: NTRK2
YTLIAKN2.7.10.1;Receptor protein-tyrosine kinase. 359
  • Domain: Ig-like C2-type
SKFGMKGP2.7.10.1;Receptor protein-tyrosine kinase. 460 -
ELGEGAFGKVFLAEC2.7.10.1;Receptor protein-tyrosine kinase. 543
  • Domain: Protein kinase
LQHEHIVKFYGVC2.7.10.1;Receptor protein-tyrosine kinase. 595
  • Domain: Protein kinase
VKFYGVC2.7.10;Protein-tyrosine kinases. 601
  • Domain: Protein kinase
GDPLIMVFEYMKHGDLN2.7.10.1;Receptor protein-tyrosine kinase. 610
  • Domain: Protein kinase
FVHRDLA2.7.10;Protein-tyrosine kinases. 672
  • Active Site D=Aspartic acid at location 676 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
FVHRDLATRNC2.7.10.1;Receptor protein-tyrosine kinase. 672
  • Active Site D=Aspartic acid at location 676 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HRDLATRN2.7.10;Protein-tyrosine kinases. 674
  • Active Site D=Aspartic acid at location 676 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RWMPPESI2.7.10.1;Receptor protein-tyrosine kinase. 718
  • Domain: Protein kinase
GVVLWEI2.7.10.1;Receptor protein-tyrosine kinase. 740
  • Domain: Protein kinase
FTYGKQPW2.7.10.1;Receptor protein-tyrosine kinase. 747
  • Domain: Protein kinase
EVIECITQGRVL2.7.10.1;Receptor protein-tyrosine kinase. 761
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVD
SGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSAN
LAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQ
ISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPF
TVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDY
GTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARH
SKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDA
VIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKR
ELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVC
VEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRD
VYSTDYYRVGGHTMLPI
RWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNI
KGIHTLLQNLAKASPVYLDILG



DME EC Prediction for this protein is: 2.7.10.1
Check another protein