Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FYRQELNKT2.7.11.24;Mitogen-activated protein kinase. 8 -
NKTIWEVP2.7.11.24;Mitogen-activated protein kinase. 14 -
VGSGAYG2.7.11.24;Mitogen-activated protein kinase. 30
  • Domain: Protein kinase
DTKTGLR2.7.11;Protein-serine/threonine kinases. 43 -
KKLSRPFQ2.7.11.24;Mitogen-activated protein kinase. 53
  • Binding Site K=Lysine at location 53 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
RPFQSIIHA2.7.11.24;Mitogen-activated protein kinase. 57
  • Domain: Protein kinase
AKRTYRE2.7.11.24;Mitogen-activated protein kinase. 65
  • Domain: Protein kinase
YRELRLLKHM2.7.11.24;Mitogen-activated protein kinase. 69
  • Domain: Protein kinase
HENVIGLLD2.7.11.24;Mitogen-activated protein kinase. 80
  • Domain: Protein kinase
LLDVFTP2.7.11.24;Mitogen-activated protein kinase. 86
  • Domain: Protein kinase
EEFNDVY2.7.11.24;Mitogen-activated protein kinase. 97
  • Domain: Protein kinase
VYLVTHLM2.7.11.24;Mitogen-activated protein kinase. 102
  • Domain: Protein kinase
LMGADLNNIVKCQ2.7.11.24;Mitogen-activated protein kinase. 108
  • Domain: Protein kinase
DDHVQFL2.7.11.24;Mitogen-activated protein kinase. 124
  • Domain: Protein kinase
YQILRGLKY2.7.11.24;Mitogen-activated protein kinase. 132
  • Domain: Protein kinase
GLKYIHSA2.7.11.24;Mitogen-activated protein kinase. 137
  • Domain: Protein kinase
LKYIHSA2.7.11;Protein-serine/threonine kinases. 138
  • Domain: Protein kinase
AVNEDCEL2.7.11.24;Mitogen-activated protein kinase. 157
  • Domain: Protein kinase
LKILDFGLAR2.7.11.24;Mitogen-activated protein kinase. 164
  • Active Site D=Aspartic acid at location 168 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
ILDFGLA2.7.11;Protein-serine/threonine kinases. 166
  • Active Site D=Aspartic acid at location 168 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
LDFGLAR2.7.11;Protein-serine/threonine kinases. 167
  • Active Site D=Aspartic acid at location 168 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
YVATRWYR2.7.11;Protein-serine/threonine kinases. 182
  • Domain: Protein kinase
TRWYRAPE2.7.11;Protein-serine/threonine kinases. 185
  • Domain: Protein kinase
YRAPEIML2.7.11.24;Mitogen-activated protein kinase. 188
  • Domain: Protein kinase
QTVDIWSVGCIMAE2.7.11.24;Mitogen-activated protein kinase. 202
  • Domain: Protein kinase
DIWSVGCI2.7.11;Protein-serine/threonine kinases. 205
  • Domain: Protein kinase
LFPGTDHI2.7.11.24;Mitogen-activated protein kinase. 222
  • Domain: Protein kinase
ISSESARNYI2.7.11.24;Mitogen-activated protein kinase. 250
  • Domain: Protein kinase
VFIGANP2.7.11.24;Mitogen-activated protein kinase. 273
  • Domain: Protein kinase
DLLEKML2.7.11.24;Mitogen-activated protein kinase. 283
  • Domain: Protein kinase
AHAYFAQ2.7.11;Protein-serine/threonine kinases. 304
  • Domain: Protein kinase
YHDPDDEP2.7.11.24;Mitogen-activated protein kinase. 311 -
ADPYDQSFESRDL2.7.11.24;Mitogen-activated protein kinase. 320 -
FVPPPLD2.7.11.24;Mitogen-activated protein kinase. 348
  • Gene: MK14

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFN
DVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHY
N
QTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QAL
AHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES



DME EC Prediction for this protein is: 2.7.11.24
Check another protein