Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KSEKGPVCWR2.1.1.43;Histone-lysine N-methyltransferase. 7 -
VKSEYMRLRQLKR2.1.1.43;Histone-lysine N-methyltransferase. 19 -
ERTEILNQEWKQRRIQPVHI2.1.1.43;Histone-lysine N-methyltransferase. 51 -
VSSLRGTREC2.1.1.43;Histone-lysine N-methyltransferase. 74 -
QVIPLKTL2.1.1.43;Histone-lysine N-methyltransferase. 94 -
TFIEELI2.1.1.43;Histone-lysine N-methyltransferase. 144 -
NYDGKVHG2.1.1.43;Histone-lysine N-methyltransferase. 152 -
EELKEKYKELTEQQLPGALPPECTPNIDG2.1.1.43;Histone-lysine N-methyltransferase. 238 -
ELKEKYKE2.1.1;Methyltransferases. 239 -
CFKYDCFLHPFHATPN2.1.1.43;Histone-lysine N-methyltransferase. 289 -
ATPNTYKRKN2.1.1.43;Histone-lysine N-methyltransferase. 301 -
KDTDSDRE2.1.1.43;Histone-lysine N-methyltransferase. 376 -
SSSEANSRCQTP2.1.1.43;Histone-lysine N-methyltransferase. 406 -
TKTCRQVYEF2.1.1.43;Histone-lysine N-methyltransferase. 460 -
TPPRKKK2.1.1.43;Histone-lysine N-methyltransferase. 487 -
HCRKIQLKKD2.1.1.43;Histone-lysine N-methyltransferase. 502 -
SSNHVYNY2.1.1.43;Histone-lysine N-methyltransferase. 513 -
QNFCEKFC2.1.1.43;Histone-lysine N-methyltransferase. 540 -
CQNRFPGCRCK2.1.1.43;Histone-lysine N-methyltransferase. 553 -
QCNTKQCPCYLAVRECDPDLCLTCGA2.1.1.43;Histone-lysine N-methyltransferase. 565 -
VSCKNCSIQRG2.1.1.43;Histone-lysine N-methyltransferase. 599 -
KKHLLLAPSDVAGWG2.1.1.43;Histone-lysine N-methyltransferase. 611
  • Domain: SET
ISQDEADRRGKVYDKYM2.1.1.43;Histone-lysine N-methyltransferase. 646
  • Domain: SET
SFLFNLN2.1.1.43;Histone-lysine N-methyltransferase. 664
  • Domain: SET
PNCYAKV2.1.1.43;Histone-lysine N-methyltransferase. 693
  • Domain: SET
GDHRIGIFAKRAIQ2.1.1.43;Histone-lysine N-methyltransferase. 704
  • Domain: SET
GEELFFDY2.1.1.43;Histone-lysine N-methyltransferase. 719
  • Domain: SET
DYRYSQADALKYVGIERE2.1.1.43;Histone-lysine N-methyltransferase. 725
  • Domain: SET

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKT
L
NAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQ
KDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTA
EELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKN
TETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEK
KDETS
SSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWA
A
HCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRG
SKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVM
MVN
GDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP



DME EC Prediction for this protein is: 2.1.1.43
Check another protein