Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
CEVVMGNLEI2.7.10.1;Receptor protein-tyrosine kinase. 56 -
REVTGYVLVA2.7.10.1;Receptor protein-tyrosine kinase. 81 -
ECAGGCSGP2.7.10.1;Receptor protein-tyrosine kinase. 233 -
DTDCFAC2.7.10.1;Receptor protein-tyrosine kinase. 243 -
CPHNFVVD2.7.10.1;Receptor protein-tyrosine kinase. 293 -
QTVDSSNID2.7.10.1;Receptor protein-tyrosine kinase. 346 -
NCTKING2.7.10.1;Receptor protein-tyrosine kinase. 358 -
LNIQSWPP2.7.10.1;Receptor protein-tyrosine kinase. 402 -
SLKEISAG2.7.10.1;Receptor protein-tyrosine kinase. 449 -
ELVEPLTPSG2.7.10.1;Receptor protein-tyrosine kinase. 693 -
VKIPVAIK2.7.10.1;Receptor protein-tyrosine kinase. 744
  • Domain: Protein kinase
EHKDNIGSQ2.7.10.1;Receptor protein-tyrosine kinase. 810
  • Domain: Protein kinase
LLNWCVQIAKGM2.7.10.1;Receptor protein-tyrosine kinase. 820
  • Domain: Protein kinase
RLVHRDLAARNVLVKSPNHVKITDFGLARLL2.7.10.1;Receptor protein-tyrosine kinase. 838
  • Active Site D=Aspartic acid at location 843 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 842
  • Active Site D=Aspartic acid at location 843 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLV2.7.10;Protein-tyrosine kinases. 845
  • Domain: Protein kinase
SDVWSYGVT2.7.10;Protein-tyrosine kinases. 901
  • Domain: Protein kinase
KPYDGIP2.7.10.1;Receptor protein-tyrosine kinase. 919
  • Domain: Protein kinase
GERLPQP2.7.10;Protein-tyrosine kinases. 936
  • Domain: Protein kinase
GERLPQPPICTI2.7.10.1;Receptor protein-tyrosine kinase. 936
  • Domain: Protein kinase
MVKCWMID2.7.10.1;Receptor protein-tyrosine kinase. 953
  • Domain: Protein kinase
MARDPQR2.7.10.1;Receptor protein-tyrosine kinase. 977
  • Domain: Protein kinase
RYLVIQG2.7.10.1;Receptor protein-tyrosine kinase. 983
  • Domain: Protein kinase
AFDNPDYW2.7.10.1;Receptor protein-tyrosine kinase. 1236 -
AENPEYL2.7.10.1;Receptor protein-tyrosine kinase. 1279 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLE
NLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGP
TENHCQTLTRTVCAEQCDGRCYGPYVSDCCHR
ECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITG
F
LNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEG
MVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLET
ELVEPLTP
SG
TAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMP
HGCLLEYVH
EHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPND
SKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAE
IFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAED
EYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKK
AFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPP
YRHRNTVV



DME EC Prediction for this protein is: 2.7.10.1
Check another protein