Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SPSPLSMKQ2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 53 -
NACEKTS2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 69 -
ELPVRLAN2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 82 -
TPSVQLV2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 104 -
QYFLDRFY2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 178
  • Domain: Histidine kinase
RISIRML2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 188
  • Domain: Histidine kinase
VYVPSHL2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 267
  • Domain: Histidine kinase
KNAMRAT2.7.11;Protein-serine/threonine kinases. 282
  • Domain: Histidine kinase
SDRGGGV2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 317
  • Domain: Histidine kinase
GGGVPLR2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 320
  • Domain: Histidine kinase
YMYSTAP2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 334
  • Domain: Histidine kinase
GYGLPISRLYA2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 356
  • Domain: Histidine kinase
YFQGDLKLYS2.7.11.2;[Pyruvate dehydrogenase (acetyl-transferring)] kinase. 368
  • Domain: Histidine kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDN
LLR
TPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSL
LFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQV
VYVPSHLYHMVFELFKNAMRATMEHHANRGVYPP
IQVHVTLGNEDLTVKM
SDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERL
PVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA



DME EC Prediction for this protein is: 2.7.11.2
Check another protein