Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TRRRREIEN1.3.3.6;Acyl-CoA oxidase. 30
  • Gene: ACOX1
DPDFQHE1.3.3.6;Acyl-CoA oxidase. 43
  • Gene: ACOX1
GLETTAT1.3.3.6;Acyl-CoA oxidase. 149 -
DNGYLKMDN1.3.3.6;Acyl-CoA oxidase. 236
  • Gene: ACOX1
NKLTYGTMVF1.3.3.6;Acyl-CoA oxidase. 271
  • Gene: ACOX1
RYSAVRHQSEI1.3.3.6;Acyl-CoA oxidase. 302
  • Gene: ACOX1
QTQQYKLFPLLATAYAFQFVGAYMKETY1.3.3.6;Acyl-CoA oxidase. 325
  • Gene: ACOX1
ACGGHGYSHCSG1.3.3.6;Acyl-CoA oxidase. 395
  • Gene: ACOX1
CTFEGENTVMMLQTARFLMK1.3.3.6;Acyl-CoA oxidase. 418
  • Active Site E=Glutamic acid at location 421 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Gene: ACOX1
VSYLNDLPSQRIQPQQVAVWPT1.3.3.6;Acyl-CoA oxidase. 452
  • Gene: ACOX1
LTEAYKLRAARLVEIAAKNLQ1.3.3.6;Acyl-CoA oxidase. 483
  • Gene: ACOX1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFKKLHLVNFVEPV
GLNYSMFIPTLLNQGTTAQKEKWLLSSKGLQIIGTYAQTEMGHGTHLR
GLETTATYDPETQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLITKGKCY
GLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEI
DNGYLKMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIA
I
RYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHG
YSHCSG
LPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAK
NLQ
KEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIR
SDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL



DME EC Prediction for this protein is: 1.3.3.6
Check another protein