Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WLLGLLRQHGC2.1.1.20;Glycine N-methyltransferase. 48
  • Gene: GNMT
RVLDVACGTGVDSIMLVEEGFSV2.1.1.20;Glycine N-methyltransferase. 60
  • Gene: GNMT
SVDASDKMLKYALKERWNRR2.1.1.20;Glycine N-methyltransferase. 84
  • Gene: GNMT
WVIEEANW2.1.1.20;Glycine N-methyltransferase. 111
  • Gene: GNMT
GDQSEHRLALKNI2.1.1.20;Glycine N-methyltransferase. 151
  • Gene: GNMT
GGLLVIDHRNYD2.1.1.20;Glycine N-methyltransferase. 170
  • Gene: GNMT
PCYFIHVL2.1.1.20;Glycine N-methyltransferase. 284
  • Gene: GNMT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERW
NRR
HEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSD
LTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYI
PCYFIHVLKRTD



DME EC Prediction for this protein is: 2.1.1.20
Check another protein