Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ECIYYNANWE2.7.11.30;Receptor protein serine/threonine kinase. 28 -
DKRLHCYASWRN2.7.11.30;Receptor protein serine/threonine kinase. 54
  • Gene: AVR2B
IELVKKGCWLDDFNCYDRQEC2.7.11.30;Receptor protein serine/threonine kinase. 70
  • Gene: AVR2B
FCCCEGN2.7.11.30;Receptor protein serine/threonine kinase. 101 -
LLAFWMYRHRKP2.7.11.30;Receptor protein serine/threonine kinase. 154
  • Gene: AVR2B
GLKPLQLL2.7.11.30;Receptor protein serine/threonine kinase. 186 -
KARGRFGCVWKA2.7.11.30;Receptor protein serine/threonine kinase. 196
  • Domain: Protein kinase
VAVKIFP2.7.11.30;Receptor protein serine/threonine kinase. 214
  • Binding Site K=Lysine at location 217 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
QDKQSWQ2.7.11.30;Receptor protein serine/threonine kinase. 222
  • Domain: Protein kinase
PGMKHEN2.7.11.30;Receptor protein serine/threonine kinase. 237
  • Domain: Protein kinase
FIAAEKRGSNLE2.7.11.30;Receptor protein serine/threonine kinase. 247
  • Domain: Protein kinase
  • Gene: AVR2B
WLITAFH2.7.11.30;Receptor protein serine/threonine kinase. 262
  • Domain: Protein kinase
WNELCHVAETM2.7.11.30;Receptor protein serine/threonine kinase. 284
  • Domain: Protein kinase
  • Gene: AVR2B
YLHEDVP2.7.11.30;Receptor protein serine/threonine kinase. 300
  • Domain: Protein kinase
  • Gene: AVR2B
KSKNVLL2.7.11.30;Receptor protein serine/threonine kinase. 323
  • Domain: Protein kinase
LADFGLA2.7.11;Protein-serine/threonine kinases. 337
  • Binding Site D=Aspartic acid at location 339 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
RYMAPEVL2.7.11.30;Receptor protein serine/threonine kinase. 363
  • Domain: Protein kinase
YMAPEVL2.7.11;Protein-serine/threonine kinases. 364
  • Domain: Protein kinase
AFLRIDMYAMGLVLWEL2.7.11.30;Receptor protein serine/threonine kinase. 380
  • Domain: Protein kinase
AADGPVDEY2.7.11.30;Receptor protein serine/threonine kinase. 402
  • Domain: Protein kinase
EEIGQHPSLE2.7.11.30;Receptor protein serine/threonine kinase. 416
  • Domain: Protein kinase
QEVVVHKK2.7.11.30;Receptor protein serine/threonine kinase. 428
  • Domain: Protein kinase
TIEECWDHDAEARLSAGC2.7.11.30;Receptor protein serine/threonine kinase. 456
  • Domain: Protein kinase
SVNGTTSDCLVS2.7.11.30;Receptor protein serine/threonine kinase. 484
  • Gene: AVR2B

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVY
FCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPPPSPLVGLKPLQLLEIKARGR
FGCVWKA
QLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVP
WCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRC
K
AADGPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSV
TNVDLPPKESSI



DME EC Prediction for this protein is: 2.7.11.30
Check another protein