Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KVCYYYDGD3.5.1.98;Histone deacetylase. 10 -
HPMKPHR3.5.1.98;Histone deacetylase. 28 -
LNYGLYR3.5.1.98;Histone deacetylase. 43 -
IRPDNMSEY3.5.1.98;Histone deacetylase. 79 -
FNVGEDCP3.5.1.98;Histone deacetylase. 94 -
AVKLNKQ3.5.1.98;Histone deacetylase. 121 -
GGLHHAKK3.5.1.98;Histone deacetylase. 137
  • Active Site H=Histidine at location 141 on the protein
  • Active Site Description: By similarity.
LELLKYH3.5.1.98;Histone deacetylase. 161 -
RVLYIDID3.5.1.98;Histone deacetylase. 169 -
DIDIHHGDGV3.5.1.98;Histone deacetylase. 174 -
HHGDGVEEAFY3.5.1.98;Histone deacetylase. 178 -
DRVMTVSFH3.5.1.98;Histone deacetylase. 191 -
VSFHKYG3.5.1.98;Histone deacetylase. 196 -
GEYFPGTG3.5.1.98;Histone deacetylase. 202 -
DIGAGKGK3.5.1.98;Histone deacetylase. 213 -
LRDGIDD3.5.1.98;Histone deacetylase. 228 -
DGIDDESY3.5.1.98;Histone deacetylase. 230 -
AVVLQCG3.5.1.98;Histone deacetylase. 256 -
DRLGCFNL3.5.1.98;Histone deacetylase. 269 -
KGHAKCVE3.5.1.98;Histone deacetylase. 279 -
FVKSFNLPM3.5.1.98;Histone deacetylase. 287 -
GGGGYTIRNV3.5.1.98;Histone deacetylase. 299 -
RCWTYET3.5.1.98;Histone deacetylase. 310 -
NELPYNDYFEYFGPDFKLHISPSNMTNQNT3.5.1.98;Histone deacetylase. 326 -
EYLEKIK3.5.1.98;Histone deacetylase. 357 -
RLFENLRMLPHAPGVQ3.5.1.98;Histone deacetylase. 365 -
PDKRISI3.5.1.98;Histone deacetylase. 401 -
SDKRIAC3.5.1.98;Histone deacetylase. 410 -
NFKKAKRVKTE3.5.1.98;Histone deacetylase. 436
  • Gene: HDAC1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDC
P
VFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHK
YGEYFPGTG
DLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNV
ARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDD
PDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA



DME EC Prediction for this protein is: 3.5.1.98
Check another protein