Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EQGEDIT5.2.1.8;Peptidylprolyl isomerase. 20
  • Gene: FKBP5
KKDRGVLKIVKRVG5.2.1.8;Peptidylprolyl isomerase. 28
  • Gene: FKBP5
ETPMIGD5.2.1.8;Peptidylprolyl isomerase. 45 -
GKKFDSS5.2.1.8;Peptidylprolyl isomerase. 64
  • Domain: PPIase FKBP-type
CKPEYAYG5.2.1.8;Peptidylprolyl isomerase. 107
  • Domain: PPIase FKBP-type
FEIELLDF5.2.1.8;Peptidylprolyl isomerase. 130
  • Domain: PPIase FKBP-type
EDGGIIRR5.2.1.8;Peptidylprolyl isomerase. 144 -
GEGYSNPNEGA5.2.1.8;Peptidylprolyl isomerase. 156
  • Gene: FKBP5
LKSFEKAK5.2.1.8;Peptidylprolyl isomerase. 247
  • Domain: PPIase FKBP-type
KIVSWLE5.2.1.8;Peptidylprolyl isomerase. 293 -
KLREYTKAVECCDKALGLDSAN5.2.1.8;Peptidylprolyl isomerase. 329
  • Gene: FKBP5
FESAKGDFEKVL5.2.1.8;Peptidylprolyl isomerase. 367
  • Gene: FKBP5
AARLQISMCQ5.2.1.8;Peptidylprolyl isomerase. 386
  • Gene: FKBP5
KAKEHNERDRR5.2.1.8;Peptidylprolyl isomerase. 397
  • Gene: FKBP5

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKG
EICHLL
CKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPI
GIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVT
LKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYL
KLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKE
HNERDRR
IYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV



DME EC Prediction for this protein is: 5.2.1.8
Check another protein