Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RYVELFIVVD3.4.24;Metalloendopeptidases. 212
  • Domain: Peptidase M12B
LVGLEIW3.4.24;Metalloendopeptidases. 259
  • Domain: Peptidase M12B
HELGHNLG3.4.24;Metalloendopeptidases. 347
  • Active Site E=Glutamic acid at location 348 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 347 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Domain: Peptidase M12B
GEECDCG3.4.24;Metalloendopeptidases. 425
  • Metal Site E=Glutamic acid at location 426 on the protein
  • Metal Site Description: Calcium 1.
  • Domain: Disintegrin
KCHGHGVC3.4.24;Metalloendopeptidases. 649
  • Domain: EGF-like
GGSVDSGP3.4.24;Metalloendopeptidases. 679 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKE
GTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQL
LRRRRAVLPQT
RYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDS
AQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVA
HELGHNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGN
CLLNIPKPDEAYSAPSCGNKLVDA
GEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSSQFCQPDVFIQ
NGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKC
WGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQK
KCHGHGVCNSNKNCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLL
VFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYANRFAVPTYAAKQPQQFPSRPPPPQPKVSSQ
GNLIPARPAPAPPLYSSLT



DME EC Prediction for this protein is: 3.4.24
Check another protein