Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FHKIYIQ4.6.1.1;Adenylate cyclase. 291 -
ADIVGFT4.6.1.1;Adenylate cyclase. 307
  • Metal Site D=Aspartic acid at location 308 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
LASQCTAQELV4.6.1.1;Adenylate cyclase. 315
  • Domain: Guanylate cyclase
LNELFGKFD4.6.1.1;Adenylate cyclase. 328 -
RIKILGDCYYC4.6.1.1;Adenylate cyclase. 346
  • Metal Site D=Aspartic acid at location 352 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
DHAHCCVEMG4.6.1.1;Adenylate cyclase. 366
  • Domain: Guanylate cyclase
VEMGLDMID4.6.1.1;Adenylate cyclase. 372 -
VLCGVLGLRKWQ4.6.1.1;Adenylate cyclase. 404 -
WQYDVWS4.6.1.1;Adenylate cyclase. 414 -
LNGDYEVEPG4.6.1.1;Adenylate cyclase. 448 -
ECLRLLNEII4.6.1.1;Adenylate cyclase. 892
  • Domain: Guanylate cyclase
EKIKTIG4.6.1.1;Adenylate cyclase. 917
  • Domain: Guanylate cyclase
TVNVASR4.6.1.1;Adenylate cyclase. 1002
  • Domain: Guanylate cyclase
SRMDSTGV4.6.1.1;Adenylate cyclase. 1007
  • Domain: Guanylate cyclase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAGAPRGGGGGGGGAGEPGGAERAAGTSRRRGLRACDEEFACPELEALFRGYTLRLEQAATLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCV
LFLALLVVTNVRSLQVPQLQQVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTA
TLVPAKRPRLWRTLGANALLFVGVNMYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERI
FHKIYIQRHD
NVSILF
ADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLH
TGR
VLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMK
FKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQK
YHQLQDEYFTSAVVLTLILAALFGLVYLLIFPQSVVVLLLLVFCICFLVACVLYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWS
SKPNSSLVVLSSGGQRTALPTLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGAVSGRSYEPIVAILLFSCALAL
HARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGV
ECLRLLNEI
I
ADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWG
N
TVNVASRMDSTGVQGRIQVTEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQIRSLGLDRKMCPFGRAGLQGRRPPVCPMPGVSVRAG
LPPHSPGQYLPSAAAGKEA



DME EC Prediction for this protein is: 4.6.1.1
Check another protein