Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
IRHGDATDVRGIIQKIVDSHKVK2.7.10.2;Non-specific protein-tyrosine kinase. 56
  • Domain: FERM
  • Gene: FAK1
SEEVHWLH2.7.10.2;Non-specific protein-tyrosine kinase. 92
  • Domain: FERM
  • Gene: FAK1
HPPEEWKYELRIRYLPKGF2.7.10.2;Non-specific protein-tyrosine kinase. 115
  • Domain: FERM
  • Gene: FAK1
NQFTEDKPTLNFFYQQVK2.7.10.2;Non-specific protein-tyrosine kinase. 135
  • Domain: FERM
  • Gene: FAK1
EMRGNALEKKSNYEVLEKDVGL2.7.10.2;Non-specific protein-tyrosine kinase. 182
  • Domain: FERM
  • Gene: FAK1
DKECFKCALGSSWIISVELAIGPEEGISYLTDKG2.7.10.2;Non-specific protein-tyrosine kinase. 254
  • Domain: FERM
  • Gene: FAK1
QVQTIQYS2.7.10.2;Non-specific protein-tyrosine kinase. 298
  • Domain: FERM
  • Gene: FAK1
SEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDG2.7.10.2;Non-specific protein-tyrosine kinase. 307
  • Domain: FERM
  • Gene: FAK1
AENMADLIDGYCRL2.7.10.2;Non-specific protein-tyrosine kinase. 337
  • Domain: FERM
ETDDYAEIIDEEDTYTMPS2.7.10.2;Non-specific protein-tyrosine kinase. 393
  • Gene: FAK1
AVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGV2.7.10.2;Non-specific protein-tyrosine kinase. 450
  • Binding Site K=Lysine at location 454 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
  • Gene: FAK1
AARNVLV2.7.10;Protein-tyrosine kinases. 548
  • Domain: Protein kinase
CVKLGDFGLSRY2.7.10.2;Non-specific protein-tyrosine kinase. 559
  • Domain: Protein kinase
PESINFRRFT2.7.10.2;Non-specific protein-tyrosine kinase. 591
  • Domain: Protein kinase
VCMWEIL2.7.10.2;Non-specific protein-tyrosine kinase. 610
  • Domain: Protein kinase
GVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKC2.7.10.2;Non-specific protein-tyrosine kinase. 619
  • Domain: Protein kinase
  • Gene: FAK1
QQEERMRMESRRQ2.7.10.2;Non-specific protein-tyrosine kinase. 686
  • Gene: FAK1
TVSWDSGGSDEAPPKPSRPGYPSPRSSEGF2.7.10.2;Non-specific protein-tyrosine kinase. 700
  • Gene: FAK1
GNQHIYQPVGKPD2.7.10.2;Non-specific protein-tyrosine kinase. 856
  • Gene: FAK1
APPKKPPRPGAP2.7.10.2;Non-specific protein-tyrosine kinase. 871
  • Gene: FAK1
PTANLDR2.7.10.2;Non-specific protein-tyrosine kinase. 913 -
NDKVYENVTGLVKAVIEMSS2.7.10.2;Non-specific protein-tyrosine kinase. 921
  • Gene: FAK1
IQPAPPEEYVPMVK2.7.10.2;Non-specific protein-tyrosine kinase. 942
  • Gene: FAK1
LPASTHREIEMAQKLLNSDL2.7.10.2;Non-specific protein-tyrosine kinase. 975
  • Gene: FAK1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHV
DMGVSSVREKYELA
HPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKD
VGL
KRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYS
NSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEI
IDEEDTYTMPS
TRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIME
LCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDI
AARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQAT
VSWDSGGSDEAPPKPSRPGYPSPRSSEGF
YPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIG
QVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPI
GNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPP
PTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINK
MKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH



DME EC Prediction for this protein is: 2.7.10.2
Check another protein