Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VYQKGCFQVYEQGKMTCKTPPSP2.7.11.30;Receptor protein serine/threonine kinase. 65
  • Gene: ACVR1
QAVECCQG2.7.11.30;Receptor protein serine/threonine kinase. 89
  • Gene: ACVR1
LPTKGKSFPG2.7.11.30;Receptor protein serine/threonine kinase. 107
  • Gene: ACVR1
QNFHLEVGLIILSVVFAVCL2.7.11.30;Receptor protein serine/threonine kinase. 118
  • Gene: ACVR1
EYGTIEGLI2.7.11.30;Receptor protein serine/threonine kinase. 163
  • Gene: ACVR1
SGSGSGLP2.7.11.30;Receptor protein serine/threonine kinase. 190
  • Domain: GS
GSGSGLPFLVQRTVARQ2.7.11.30;Receptor protein serine/threonine kinase. 191
  • Domain: GS
ECVGKGRYGEVWRG2.7.11.30;Receptor protein serine/threonine kinase. 212
  • Domain: Protein kinase
VAVKIFSSR2.7.11.30;Receptor protein serine/threonine kinase. 232
  • Binding Site K=Lysine at location 235 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
NILGFIASDMTSR2.7.11.30;Receptor protein serine/threonine kinase. 261
  • Domain: Protein kinase
SSTQLWLITHYHE2.7.11.30;Receptor protein serine/threonine kinase. 275
  • Domain: Protein kinase
ASGLAHLH2.7.11.30;Receptor protein serine/threonine kinase. 313
  • Domain: Protein kinase
EIFGTQGK2.7.11.30;Receptor protein serine/threonine kinase. 322
  • Domain: Protein kinase
KPAIAHRD2.7.11.30;Receptor protein serine/threonine kinase. 329
  • Domain: Protein kinase
HRDLKSKNILVKKNG2.7.11.30;Receptor protein serine/threonine kinase. 334
  • Active Site D=Aspartic acid at location 336 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
CCIADLGLA2.7.11.30;Receptor protein serine/threonine kinase. 350
  • Domain: Protein kinase
IADLGLA2.7.11;Protein-serine/threonine kinases. 352
  • Domain: Protein kinase
RVGTKRYM2.7.11.30;Receptor protein serine/threonine kinase. 375
  • Domain: Protein kinase
RYMAPEVL2.7.11.30;Receptor protein serine/threonine kinase. 380
  • Domain: Protein kinase
YMAPEVL2.7.11;Protein-serine/threonine kinases. 381
  • Domain: Protein kinase
DCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYD2.7.11.30;Receptor protein serine/threonine kinase. 394
  • Domain: Protein kinase
  • Gene: ACVR1
VPNDPSFEDM2.7.11.30;Receptor protein serine/threonine kinase. 435
  • Domain: Protein kinase
KVVCVDQQ2.7.11.30;Receptor protein serine/threonine kinase. 446
  • Domain: Protein kinase
RPNIPNRW2.7.11.30;Receptor protein serine/threonine kinase. 454
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCN
RNITAQ
LPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLV
QRTVARQ
ITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSI
ASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYK
RVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYD
VVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDN
SLDKLKTDC



DME EC Prediction for this protein is: 2.7.11.30
Check another protein