Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QKKPTMYP2.7.11.13;Protein kinase C. 47
  • Domain: C2
WGLNKQGY2.7.11.13;Protein kinase C. 181 -
CNAAIHKKCIDK2.7.11.13;Protein kinase C. 193 -
IDMPHRFK2.7.11.13;Protein kinase C. 228 -
HCGTLLWGL2.7.11.13;Protein kinase C. 247 -
KVANLCGINQKL2.7.11.13;Protein kinase C. 276 -
GKGSFGKV2.7.11;Protein-serine/threonine kinases. 387
  • Domain: Protein kinase
FAIKALKK2.7.11.13;Protein kinase C. 406
  • Binding Site K=Lysine at location 409 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
DDDVECTMVEKRVL2.7.11.13;Protein kinase C. 419
  • Domain: Protein kinase
VMEYLNGGD2.7.11;Protein-serine/threonine kinases. 457
  • Domain: Protein kinase
YRDLKLDN2.7.11.13;Protein kinase C. 502
  • Active Site D=Aspartic acid at location 504 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKLDN2.7.11;Protein-serine/threonine kinases. 503
  • Active Site D=Aspartic acid at location 504 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
LDKDGHIK2.7.11;Protein-serine/threonine kinases. 512
  • Domain: Protein kinase
GHIKIAD2.7.11;Protein-serine/threonine kinases. 516
  • Domain: Protein kinase
DFGMCKE2.7.11.13;Protein kinase C. 522
  • Domain: Protein kinase
TFCGTPDYIAPEI2.7.11.13;Protein kinase C. 538
  • Domain: Protein kinase
GTPDYIAPE2.7.11;Protein-serine/threonine kinases. 541
  • Domain: Protein kinase
YIAPEIL2.7.11;Protein-serine/threonine kinases. 545
  • Domain: Protein kinase
VDWWSFGVLLYEML2.7.11.13;Protein kinase C. 560
  • Domain: Protein kinase
GVLLYEM2.7.11;Protein-serine/threonine kinases. 566
  • Domain: Protein kinase
GQSPFHG2.7.11.13;Protein kinase C. 575
  • Domain: Protein kinase
PPFRPKVKSP2.7.11.13;Protein kinase C. 649
  • Domain: AGC-kinase C-termina

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNN
GKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKK
CIDK
VIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKML
GKGSFGKVFLAEFK
KTNQF
FAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGI
V
YRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEID
PPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPG
MERLIS



DME EC Prediction for this protein is: 2.7.11.13
Check another protein