Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EHPSVTLFRQYLRI3.5.1.14;Aminoacylase. 9 -
PDYGAAVAF3.5.1.14;Aminoacylase. 29 -
TVLTWPGTNP3.5.1.14;Aminoacylase. 61 -
SILLNSHTDVVPVFKEHW3.5.1.14;Aminoacylase. 74
  • Active Site D=Aspartic acid at location 82 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 80 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
RGAQDMK3.5.1;In linear amides. 109
  • Metal Site D=Aspartic acid at location 113 on the protein
  • Metal Site Description: Cobalt or zinc 1 (By similarit
PTDAFTVFYSERSPWW3.5.1.14;Aminoacylase. 180 -
PGHASRF3.5.1.14;Aminoacylase. 204 -
SILAFREKE3.5.1.14;Aminoacylase. 225 -
QLQSWCQ3.5.1.14;Aminoacylase. 289 -
PWWAAFS3.5.1.14;Aminoacylase. 322 -
RYIRAVG3.5.1.14;Aminoacylase. 350 -
PALGFSPMN3.5.1.14;Aminoacylase. 358 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFK
DSEGYIYA
RGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTS
TGR
PGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEG
VTLEFAQKWMHPQVTPTDDSN
PWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALAS
VPALPSDS



DME EC Prediction for this protein is: 3.5.1.14
Check another protein