Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
AILGSAGMTC2.7.10.1;Receptor protein-tyrosine kinase. 750
  • Gene: TIE2
KDGLRMDAA2.7.10.1;Receptor protein-tyrosine kinase. 845
  • Domain: Protein kinase
  • Gene: TIE2
NIINLLG2.7.10.1;Receptor protein-tyrosine kinase. 884
  • Domain: Protein kinase
LLGACEHRGYLYLAIE2.7.10.1;Receptor protein-tyrosine kinase. 888
  • Domain: Protein kinase
  • Gene: TIE2
GNLLDFLRKSRVLETDPAFA2.7.10.1;Receptor protein-tyrosine kinase. 908
  • Domain: Protein kinase
KQFIHRDLAARN2.7.10.1;Receptor protein-tyrosine kinase. 958
  • Active Site D=Aspartic acid at location 964 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 963
  • Active Site D=Aspartic acid at location 964 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KIADFGLSRG2.7.10.1;Receptor protein-tyrosine kinase. 979
  • Domain: Protein kinase
WMAIESL2.7.10.1;Receptor protein-tyrosine kinase. 1004
  • Domain: Protein kinase
VSLGGTPYCGMTCAELYEKLP2.7.10.1;Receptor protein-tyrosine kinase. 1032
  • Domain: Protein kinase
NCDDEVY2.7.10.1;Receptor protein-tyrosine kinase. 1062
  • Domain: Protein kinase
QCWREKP2.7.10.1;Receptor protein-tyrosine kinase. 1073
  • Domain: Protein kinase
  • Gene: TIE2
FTYAGID2.7.10.1;Receptor protein-tyrosine kinase. 1111 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAY
FCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFT
SAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNH
TDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNE
IVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLK
GLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLI
AILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGT
LALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIK
KDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIE
YAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRL
PVR
WMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERK
TYVNTTLYEK
FTYAGIDCSAEEAA



DME EC Prediction for this protein is: 2.7.10.1
Check another protein