Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RVYLHTLAESI4.6.1.2;Guanylate cyclase. 68 -
FKICYEEDE4.6.1.2;Guanylate cyclase. 141 -
ILGVVGGTLKDFLNSFSTLLKQSSHCQEA4.6.1.2;Guanylate cyclase. 151 -
VYYFFPKR4.6.1.2;Guanylate cyclase. 202 -
KSTKPSLSP4.6.1.2;Guanylate cyclase. 260
  • Gene: GCYA3
SLFCKTFPFHFM4.6.1.2;Guanylate cyclase. 280 -
QTFSGIMTMLNMQF4.6.1.2;Guanylate cyclase. 333 -
LKGQMIY4.6.1.2;Guanylate cyclase. 366 -
ILFLGSPCVD4.6.1.2;Guanylate cyclase. 379 -
RGLYLSDIP4.6.1.2;Guanylate cyclase. 396 -
LSDIPIH4.6.1.2;Guanylate cyclase. 400 -
GEQARAQDGL4.6.1.2;Guanylate cyclase. 416 -
AQDGLKKR4.6.1.2;Guanylate cyclase. 421 -
HQALEEEKKKTVDLL4.6.1.2;Guanylate cyclase. 440 -
VAQQLWQ4.6.1.2;Guanylate cyclase. 462 -
FSDIVGFT4.6.1.2;Guanylate cyclase. 484
  • Domain: Guanylate cyclase
YKVETIGDAY4.6.1.2;Guanylate cyclase. 523
  • Metal Site D=Aspartic acid at location 530 on the protein
  • Metal Site Description: Magnesium (By similarity).
  • Domain: Guanylate cyclase
IALMALKMMELS4.6.1.2;Guanylate cyclase. 549
  • Domain: Guanylate cyclase
IKMRIGLH4.6.1.2;Guanylate cyclase. 571
  • Domain: Guanylate cyclase
RIGLHSG4.6.1.2;Guanylate cyclase. 574
  • Domain: Guanylate cyclase
MPRYCLFG4.6.1.2;Guanylate cyclase. 591
  • Domain: Guanylate cyclase
PRSREELP4.6.1.2;Guanylate cyclase. 636 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLPQRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKH
KIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV
FKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFL
H
VYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKIN
QTFSGIMTMLNMQFVVRVRRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYL
SDIPIH
NALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPL
QVITMLNALYTRFDQQCGELDV
YKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFT
PRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID



DME EC Prediction for this protein is: 4.6.1.2
Check another protein