Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PHRDFYN3.5.4.6;AMP deaminase. 405 -
TLREVFES3.5.4.6;AMP deaminase. 455 -
TFHRFDKFN3.5.4.6;AMP deaminase. 483 -
KYNPIGES3.5.4.6;AMP deaminase. 493 -
SPNVRWL3.5.4.6;AMP deaminase. 565 -
NVRWLVQ3.5.4.6;AMP deaminase. 567 -
RPHCGEAG3.5.4.6;AMP deaminase. 685
  • Active Site C=Cysteine at location 688 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 687 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
TKEPLMEEYSIATQVW3.5.4.6;AMP deaminase. 772 -
WKLSSCD3.5.4.6;AMP deaminase. 787 -
DMCELARNSVL3.5.4.6;AMP deaminase. 793 -
VKSHWLGP3.5.4.6;AMP deaminase. 811 -
RTNVPDIR3.5.4.6;AMP deaminase. 832 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRNRGQGLFRLRSRCFLHQSLPLGAGRRKGLDVAEPGPSRCRSDSPAVAAVVPAMASYPSGSGKPKAKYPFKKRASLQASTAAPEARGGLGAPPLQSARS
LPGPAPCLKHFPLDLRTSMDGKCKEIAEELFTRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQ
GEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAPVHPP
ALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDEHCSEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAA
QKKV
PHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGES
VLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLP
LFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVL
RPHCGEAGPIHHLVSA
FMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHF
TKEPLMEEYSIATQVWKLSSCDMCELARN
SVL
MSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ



DME EC Prediction for this protein is: 3.5.4.6
Check another protein