Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KFYGELA2.7.11.1;Non-specific serine/threonine protein kinase. 155
  • Gene: PRKDC
WKVPTYKDY2.7.11.1;Non-specific serine/threonine protein kinase. 519
  • Gene: PRKDC
PLISGFYKL2.7.11.1;Non-specific serine/threonine protein kinase. 661
  • Gene: PRKDC
KMKQYKDELLASCL2.7.11.1;Non-specific serine/threonine protein kinase. 717
  • Gene: PRKDC
AAQKGFN2.7.11.1;Non-specific serine/threonine protein kinase. 821
  • Gene: PRKDC
LSFAVPF2.7.11.1;Non-specific serine/threonine protein kinase. 892
  • Gene: PRKDC
AACELLHS2.7.11.1;Non-specific serine/threonine protein kinase. 929
  • Gene: PRKDC
LACDVDQVTRQLYEPLVMQLIHW2.7.11.1;Non-specific serine/threonine protein kinase. 972
  • Gene: PRKDC
GIVDPVDSTLRDFCG2.7.11.1;Non-specific serine/threonine protein kinase. 1016
  • Gene: PRKDC
SLVEQFVFEALV2.7.11.1;Non-specific serine/threonine protein kinase. 1094
  • Gene: PRKDC
CGRPQTECRHK2.7.11.1;Non-specific serine/threonine protein kinase. 1176
  • Gene: PRKDC
YNYSKCT2.7.11.1;Non-specific serine/threonine protein kinase. 1330
  • Gene: PRKDC
LKSRFTK2.7.11.1;Non-specific serine/threonine protein kinase. 1851
  • Gene: PRKDC
EGNELTK2.7.11.1;Non-specific serine/threonine protein kinase. 1907
  • Gene: PRKDC
YHCAAYNCAI2.7.11.1;Non-specific serine/threonine protein kinase. 1940
  • Gene: PRKDC
KFYQGFLF2.7.11.1;Non-specific serine/threonine protein kinase. 1960
  • Gene: PRKDC
NTEEVFRPYA2.7.11.1;Non-specific serine/threonine protein kinase. 2152
  • Gene: PRKDC
GIHYMVVE2.7.11.1;Non-specific serine/threonine protein kinase. 2181
  • Gene: PRKDC
KRAVFRHNLEIIKT2.7.11.1;Non-specific serine/threonine protein kinase. 2227
  • Gene: PRKDC
KDNSVGIQLLG2.7.11.1;Non-specific serine/threonine protein kinase. 2268
  • Gene: PRKDC
FPPLADRF2.7.11.1;Non-specific serine/threonine protein kinase. 2371
  • Gene: PRKDC
ETRLPSNT2.7.11.1;Non-specific serine/threonine protein kinase. 2528
  • Gene: PRKDC
SLYSPKIE2.7.11.1;Non-specific serine/threonine protein kinase. 2544
  • Gene: PRKDC
FEHPLSEC2.7.11.1;Non-specific serine/threonine protein kinase. 2577
  • Gene: PRKDC
LRLRRRF2.7.11.1;Non-specific serine/threonine protein kinase. 2726
  • Gene: PRKDC
CLASLQQP2.7.11.1;Non-specific serine/threonine protein kinase. 2880
  • Gene: PRKDC
ELAKLYRS2.7.11.1;Non-specific serine/threonine protein kinase. 2925
  • Domain: FAT
  • Gene: PRKDC
FMQNYSSID2.7.11.1;Non-specific serine/threonine protein kinase. 3110
  • Domain: FAT
  • Gene: PRKDC
EFLRNELE2.7.11.1;Non-specific serine/threonine protein kinase. 3693
  • Gene: PRKDC
ATQFLPVPELMPFRLTRQ2.7.11.1;Non-specific serine/threonine protein kinase. 3949
  • Domain: PI3K/PI4K
  • Gene: PRKDC
TMDVFVKEP2.7.11.1;Non-specific serine/threonine protein kinase. 4001
  • Domain: PI3K/PI4K
  • Gene: PRKDC

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAGSGAGVRCSLLRLQETLSAADRCGAALAGHQLIRGLGQECVLSSSPAVLALQTSLVFSRDFGLLVFVRKSLNSIEFRECREEILKFLCIFLEKMGQKI
APYSVEIKNTCTSVYTKDRAAKCKIPALDLLIKLLQTFRSSRLMDEFKIGELFS
KFYGELALKKKIPDTVLEKVYELLGLLGEVHPSEMINNAENLFRAF
LGELKTQMTSAVREPKLPVLAGCLKGLSSLLCNFTKSMEEDPQTSREIFNFVLKAIRPQIDLKRYAVPSAGLRLFALHASQFSTCLLDNYVSLFEVLLKW
CAHTNVELKKAALSALESFLKQVSNMVAKNAEMHKNKLQYFMEQFYGIIRNVDSNNKELSIAIRGYGLFAGPCKVINAKDVDFMYVELIQRCKQMFLTQT
DTGDDRVYQMPSFLQSVASVLLYLDTVPEVYTPVLEHLVVMQIDSFPQYSPKMQLVCCRAIVKVFLALAAKGPVLRNCISTVVHQGLIRICSKPVVLPKG
PESESEDHRASGEVRTGK
WKVPTYKDYVDLFRHLLSSDQMMDSILADEAFFSVNSSSESLNHLLYDEFVKSVLKIVEKLDLTLEIQTVGEQENGDEAPGV
WMIPTSDPAANLHPAKPKDFSAFINLVEFCREILPEKQAEFFEPWVYSFSYELILQSTRL
PLISGFYKLLSITVRNAKKIKYFEGVSPKSLKHSPEDPEK
YSCFALFVKFGKEVAV
KMKQYKDELLASCLTFLLSLPHNIIELDVRAYVPALQMAFKLGLSYTPLAEVGLNALEEWSIYIDRHVMQPYYKDILPCLDGYL
KTSALSDETKNNWEVSALSR
AAQKGFNKVVLKHLKKTKNLSSNEAISLEEIRIRVVQMLGSLGGQINKNLLTVTSSDEMMKSYVAWDREKRLSFAVPFRE
MKPVIFLDVFLPRVTELALTASDRQTKV
AACELLHSMVMFMLGKATQMPEGGQGAPPMYQLYKRTFPVLLRLACDVDQVTRQLYEPLVMQLIHWFTNNKK
FESQDTVALLEAILD
GIVDPVDSTLRDFCGRCIREFLKWSIKQITPQQQEKSPVNTKSLFKRLYSLALHPNAFKRLGASLAFNNIYREFREEESLVEQFV
FEALV
IYMESLALAHADEKSLGTIQQCCDAIDHLCRIIEKKHVSLNKAKKRRLPRGFPPSASLCLLDLVKWLLAHCGRPQTECRHKSIELFYKFVPLLPG
NRSPNLWLKDVLKEEGVSFLINTFEGGGCGQPSGILAQPTLLYLRGPFSLQATLCWLDLLLAALECYNTFIGERTVGALQVLGTEAQSSLLKAVAFFLES
IAMHDIIAAEKCFGTGAAGNRTSPQEGER
YNYSKCTVVVRIMEFTTTLLNTSPEGWKLLKKDLCNTHLMRVLVQTLCEPASIGFNIGDVQVMAHLPDVCV
NLMKALKMSPYKDILETHLREKITAQSIEELCAVNLYGPDAQVDRSRLAAVVSACKQLHRAGLLHNILPSQSTDLHHSVGTELLSLVYKGIAPGDERQCL
PSLDLSCKQLASGLLELAFAFGGLCERLVSLLLNPAVLSTASLGSSQGSVIHFSHGEYFYSLFSETINTELLKNLDLAVLELMQSSVDNTKMVSAVLNGM
LDQSFRERANQKHQGLKLATTILQHWKKCDSWWAKDSPLETKMAVLALLAKILQIDSSVSFNTSHGSFPEVFTTYISLLADTKLDLHLKGQAVTLLPFFT
SLTGGSLEELRRVLEQLIVAHFPMQSREFPPGTPRFNNYVDCMKKFLDALELSQSPMLLELMTEVLCREQQHVMEELFQSSFRRIARRGSCVTQVGLLES
VYEMFRKDDPRLSFTRQSFVDRSLLTLLWHCSLDALREFFSTIVVDAIDV
LKSRFTKLNESTFDTQITKKMGYYKILDVMYSRLPKDDVHAKESKINQVF
HGSCIT
EGNELTKTLIKLCYDAFTENMAGENQLLERRRLYHCAAYNCAISVICCVFNELKFYQGFLFSEKPEKNLLIFENLIDLKRRYNFPVEVEVPMER
KKKYIEIRKEAREAANGDSDGPSYMSSLSYLADSTLSEEMSQFDFSTGVQSYSYSSQDPRPATGRFRRREQRDPTVHDDVLELEMDELNRHECMAPLTAL
VKHMHRSLGPPQGEEDSVPRDLPSWMKFLHGKLGNPIVPLNIRLFLAKLVI
NTEEVFRPYAKHWLSPLLQLAASENNGGEGIHYMVVEIVATILSWTGLA
TPTGVPKDEVLANRLLNFLMKHVFHP
KRAVFRHNLEIIKTLVECWKDCLSIPYRLIFEKFSGKDPNSKDNSVGIQLLGIVMANDLPPYDPQCGIQSSEYF
QALVNNMSFVRYKEVYAAAAEVLGLILRYVMERKNILEESLCELVAKQLKQHQNTMEDKFIVCLNKVTKS
FPPLADRFMNAVFFLLPKFHGVLKTLCLEV
VLCRVEGMTELYFQLKSKDFVQVMRHRDDERQKVCLDIIYKMMPKLKPVELRELLNPVVEFVSHPSTTCREQMYNILMWIHDNYRDPESETDNDSQEIFK
LAKDVLIQGLIDENPGLQLIIRNFWSH
ETRLPSNTLDRLLALNSLYSPKIEVHFLSLATNFLLEMTSMSPDYPNPMFEHPLSECEFQEYTIDSDWRFRST
VLTPMFVETQASQGTLQTRTQEGSLSARWPVAGQIRATQQQHDFTLTQTADGRSSFDWLTGSSTDPLVDHTSPSSDSLLFAHKRSERLQRAPLKSVGPDF
GKKRLGLPGDEVDNKVKGAAGRTDL
LRLRRRFMRDQEKLSLMYARKGVAEQKREKEIKSELKMKQDAQVVLYRSYRHGDLPDIQIKHSSLITPLQAVAQR
DPIIAKQLFSSLFSGILKEMDKFKTLSEKNNITQKLLQDFNRFLNTTFSFFPPFVSCIQDISCQHAALLSLDPAAVSAG
CLASLQQPVGIRLLEEALLRL
LPAELPAKRVRGKARLPPDVLRWV
ELAKLYRSIGEYDVLRGIFTSEIGTKQITQSALLAEARSDYSEAAKQYDEALNKQDWVDGEPTEAEKDFWELASLD
CYNHLAEWKSLEYCSTASIDSENPPDLNKIWSEPFYQETYLPYMIRSKLKLLLQGEADQSLLTFIDKAMHGELQKAILELHYSQELSLLYLLQDDVDRAK
YYIQNGIQS
FMQNYSSIDVLLHQSRLTKLQSVQALTEIQEFISFISKQGNLSSQVPLKRLLNTWTNRYPDAKMDPMNIWDDIITNRCFFLSKIEEKLTPL
PEDNSMNVDQDGDPSDRMEVQEQEEDISSLIRSCKFSMKMKMIDSARKQNNFSLAMKLLKELHKESKTRDDWLVSWVQSYCRLSHCRSRSQGCSEQVLTV
LKTVSLLDENNVSSYLSKNILAFRDQNILLGTTYRIIANALSSEPACLAEIEEDKARRILELSGSSSEDSEKVIAGLYQRAFQHLSEAVQAAEEEAQPPS
WSCGPAAGVIDAYMTLADFCDQQLRKEEENASVIDSAELQAYPALVVEKMLKALKLNSNEARLKFPRLLQIIERYPEETLSLMTKEISSVPCWQFISWIS
HMVALLDKDQAVAVQHSVEEITDNYPQAIVYPFIISSESYSFKDTSTGHKNKEFVARIKSKLDQGGVIQDFINALDQLSNPELLFKDWSNDVRAELAKTP
VNKKNIEKMYERMYAALGDPKAPGLGAFRRKFIQTFGKEFDKHFGKGGSKLLRMKLSDFNDITNMLLLKMNKDSKPPGNLKECSPWMSDFKV
EFLRNELE
IPGQYDGRGKPLPEYHVRIAGFDERVTVMASLRRPKRIIIRGHDEREHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVPMTSRL
GLIEWLENTVTLKDLLLNTMSQEEKAAYLSDPRAPPCEYKDWLTKMSGKHDVGAYMLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPEAFLAL
RSHFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGIDFGHAFGS
ATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAFRSDPGLLTN
TMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSE
ETQVKCLMDQATDPNILGRTWEGWEPWM



DME EC Prediction for this protein is: 2.7.11.1
Check another protein