Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
MGNPLLD2.7.1.20;Adenosine kinase. 29 -
KHKELFDELV2.7.1.20;Adenosine kinase. 61
  • Gene: ADK
ANLAAANCYKKEKHLDLE2.7.1.20;Adenosine kinase. 153
  • Gene: ADK
AGFFLTVSPES2.7.1.20;Adenosine kinase. 185 -
FTQGRDDT2.7.1.20;Adenosine kinase. 281
  • Gene: ADK
TESEVTA2.7.1;Phosphotransferases with an alcohol group as acceptor. 292 -
DTNGAGDAF2.7.1.20;Adenosine kinase. 311
  • Active Site D=Aspartic acid at location 317 on the protein
  • Active Site Description: By similarity.
FVGGFLSQLV2.7.1.20;Adenosine kinase. 319 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKA
ATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLI
ANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVA
HHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVI
FTQGRDDTIMATESEVTAFA
VLDQDQKEII
DTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH



DME EC Prediction for this protein is: 2.7.1.20
Check another protein