Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VIFESRP1.2.1.41;Glutamate-5-semialdehyde dehydrogenase. 478
  • Gene: PROA
LKGGKEA1.2.1.41;Glutamate-5-semialdehyde dehydrogenase. 503
  • Gene: PROA
DLIIPRG1.2.1.41;Glutamate-5-semialdehyde dehydrogenase. 553
  • Gene: PROA
GIPVMGH2.1.2.11;3-methyl-2-oxobutanoate hydroxymethyltransferase. 573 -
CNALETLL1.2.1.41;Glutamate-5-semialdehyde dehydrogenase. 612
  • Gene: PROA
FDQIIDM2.3.3.13;2-isopropylmalate synthase. 630
  • Gene: LEU1
STRFSDG1.2.1.41;Glutamate-5-semialdehyde dehydrogenase. 724
  • Gene: PROA
GAEVGIST1.2.1.41;Glutamate-5-semialdehyde dehydrogenase. 736
  • Gene: PROA
HARGPVG1.2.1.41;Glutamate-5-semialdehyde dehydrogenase. 747
  • Gene: PROA
RGPVGLEGL1.2.1.41;Glutamate-5-semialdehyde dehydrogenase. 749
  • Gene: PROA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLSQVYRCGFQPFNQHLLPWVKCTTVFRSHCIQPSVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVE
QVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKR
RNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQR
DEILLANKKDLEEAEGRLAAPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLL
VIFESRPDCLPQVAALAIASGNG
LL
LKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLVNTREEVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRL
VRDSKCEYPAA
CNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKSLRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIV
TEDENTAEFFLQHVDSACVFWNA
STRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLPIPQRNTN



DME EC Prediction for this protein is: 1.2.1.41
Check another protein