Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VLLGPPG2.7.4.3;Adenylate kinase. 19 -
GPPGAGKGT2.7.4.3;Adenylate kinase. 22 -
PGAGKGT2.7.4;Phosphotransferases with a phosphate group as acceptor. 24 -
AGKGTQA2.7.4.3;Adenylate kinase. 26 -
CHLATGDMLR2.7.4.3;Adenylate kinase. 42
  • Binding Site T=Threonine at location 46 on the protein
  • Binding site description: AMP (By similarity).
ASGSELG2.7.4.3;Adenylate kinase. 55 -
SGSELGK2.7.4.3;Adenylate kinase. 56 -
MDAGKLV2.7.4.3;Adenylate kinase. 68 -
NGFLLDG2.7.4.3;Adenylate kinase. 94 -
GFLLDGFPRT2.7.4.3;Adenylate kinase. 95 -
LDGFPRT2.7.4;Phosphotransferases with a phosphate group as acceptor. 98 -
LDGFPRTV2.7.4.3;Adenylate kinase. 98 -
EKLDSVIEF2.7.4.3;Adenylate kinase. 120
  • Gene: KAD2
RITGRLIHP2.7.4.3;Adenylate kinase. 138 -
SGRSYHEEF2.7.4.3;Adenylate kinase. 148
  • Gene: KAD2
KDDITGE2.7.4.3;Adenylate kinase. 164 -
DDITGEPL2.7.4.3;Adenylate kinase. 165 -
LIRRSDD2.7.4.3;Adenylate kinase. 172 -
AYHTQTTPL2.7.4.3;Adenylate kinase. 189
  • Gene: KAD2
VFASILAAFS2.7.4.3;Adenylate kinase. 219
  • Gene: KAD2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDG
FPRTV
RQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEY
YRKRGIHSAIDASQTPDV
VFASILAAFSKATCKDLVMFI



DME EC Prediction for this protein is: 2.7.4.3
Check another protein