Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GHNVSFD2.7.7.7;DNA-directed DNA polymerase. 268 -
DTMSMHMAISGL2.7.7.7;DNA-directed DNA polymerase. 293
  • Gene: DPOG1
GMLEMGVSYLPVNQNWERYL2.7.7.7;DNA-directed DNA polymerase. 426
  • Gene: DPOG1
EMKKSLM2.7.7.7;DNA-directed DNA polymerase. 458
  • Gene: DPOG1
LANDACQLL2.7.7.7;DNA-directed DNA polymerase. 466
  • Gene: DPOG1
YKEDPWLWDLEWD2.7.7.7;DNA-directed DNA polymerase. 479
  • Gene: DPOG1
SLQMRVTPKLM2.7.7.7;DNA-directed DNA polymerase. 593
  • Gene: DPOG1
HGWGYLVPGR2.7.7.7;DNA-directed DNA polymerase. 618
  • Gene: DPOG1
NVGSPFAKDFLP2.7.7.7;DNA-directed DNA polymerase. 761
  • Gene: DPOG1
SFWRNAHKR2.7.7.7;DNA-directed DNA polymerase. 799
  • Gene: DPOG1
GTITRRAVE2.7.7.7;DNA-directed DNA polymerase. 848 -
GSELKAM2.7.7.7;DNA-directed DNA polymerase. 871 -
HGCTAFGWMTLQG2.7.7.7;DNA-directed DNA polymerase. 911
  • Gene: DPOG1
GTDLHSKTA2.7.7.7;DNA-directed DNA polymerase. 928 -
TVGISREHAK2.7.7.7;DNA-directed DNA polymerase. 938
  • Gene: DPOG1
FNYGRIYGAG2.7.7.7;DNA-directed DNA polymerase. 949 -
FAERLLMQFNHRL2.7.7.7;DNA-directed DNA polymerase. 961
  • Gene: DPOG1
GGTESEMFNKLESIA2.7.7.7;DNA-directed DNA polymerase. 1051
  • Gene: DPOG1
TSRVNWVVQSSAVDYLHLMLV2.7.7.7;DNA-directed DNA polymerase. 1094
  • Gene: DPOG1
CISIHDE2.7.7.7;DNA-directed DNA polymerase. 1130 -
DRYRAALALQITNLLTRCMFA2.7.7.7;DNA-directed DNA polymerase. 1145
  • Gene: DPOG1
AFFSAVD2.7.7.7;DNA-directed DNA polymerase. 1178 -
CLRKEVTM2.7.7.7;DNA-directed DNA polymerase. 1188
  • Gene: DPOG1
TMDCKTPSNP2.7.7.7;DNA-directed DNA polymerase. 1194
  • Gene: DPOG1
TPSNPTGME2.7.7.7;DNA-directed DNA polymerase. 1199
  • Gene: DPOG1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSRLLWRKVAGATVGPGPVPAPGRWVSSSVPASDPSDGQRRRQQQQQQQQQQQQQPQQPQVLSSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAV
RRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVE
VCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVV
GHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMA
ISGL
SSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLDISSVNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDV
WATHEVFQQQLPLFLERCPHPVTLA
GMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKA
KKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLL
SLQMRVTP
KLM
ALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTDNSAIWQTVEELDYLEVE
AEAKMENLRAAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSC
NVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISF
WRNAHKR
ISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAA
VLGDAHFAGM
HGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDE
GEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWK
GGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWV
VQSSAVDYLHLMLV
AMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTP
SNPTGME
RRYGIPQGEALDIYQIIELTKGSLEKRSQPGP



DME EC Prediction for this protein is: 2.7.7.7
Check another protein