Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KPDQLIKRRGK2.3.3.8;ATP citrate synthase. 58 -
LDGVKSWLKPRLG2.3.3.8;ATP citrate synthase. 78
  • Gene: ACLY
KAQKLLVGVDEKLN2.3.3.8;ATP citrate synthase. 148
  • Gene: ACLY
HLLVHAPEDKKE2.3.3.8;ATP citrate synthase. 168
  • Gene: ACLY
FTYLEINP2.3.3.8;ATP citrate synthase. 197 -
ELANYGEYSG2.3.3.8;ATP citrate synthase. 300 -
LIIGGSIANFTNVA2.3.3.8;ATP citrate synthase. 338
  • Gene: ACLY
VTIFVRRGGPNYQEGLR2.3.3.8;ATP citrate synthase. 373
  • Gene: ACLY
ETHMTAIVG2.3.3.8;ATP citrate synthase. 408
  • Gene: ACLY
DEVAPAKKAKPAM2.3.3.8;ATP citrate synthase. 462
  • Gene: ACLY
TLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAM2.3.3.8;ATP citrate synthase. 491
  • Gene: ACLY
QIRTIAIIAEGIPEALTRKLIKKA2.3.3.8;ATP citrate synthase. 590
  • Gene: ACLY
GPATVGGIKPGCFKIGNTGGM2.3.3.8;ATP citrate synthase. 622 -
ASKLYRPGSVAYVS2.3.3.8;ATP citrate synthase. 648 -
SGGMSNELNNIIS2.3.3.8;ATP citrate synthase. 663 -
TTDGVYEG2.3.3.8;ATP citrate synthase. 677 -
AIGGDRYPG2.3.3.8;ATP citrate synthase. 686 -
GVKMIVVLGEIGGTEEYKICRG2.3.3.8;ATP citrate synthase. 709
  • Metal Site E=Glutamic acid at location 718 on the protein
  • Metal Site Description: Magnesium (By similarity).
  • Gene: ACLY
WCIGTCA2.3.3.8;ATP citrate synthase. 743
  • Gene: ACLY
EVQFGHAG2.3.3.8;ATP citrate synthase. 755
  • Active Site H=Histidine at location 760 on the protein
  • Active Site Description: Tele-phosphohistidine intermed
ETAVAKNQA2.3.3.8;ATP citrate synthase. 770 -
ELGLIRKPA2.3.3.8;ATP citrate synthase. 830 -
TADHGPAVSGA2.3.3.8;ATP citrate synthase. 897 -
VSGAHNTI2.3.3.8;ATP citrate synthase. 904
  • Gene: ACLY
SSLTSGLLTIGDRFGGALD2.3.3.8;ATP citrate synthase. 922
  • Gene: ACLY
GIGHRVKS2.3.3.8;ATP citrate synthase. 972 -
NLILNVDG2.3.3.8;ATP citrate synthase. 1020 -
GFIGHYLDQ2.3.3.8;ATP citrate synthase. 1068
  • Gene: ACLY
KQGLYRH2.3.3.8;ATP citrate synthase. 1080
  • Gene: ACLY
LYRHPWDD2.3.3.8;ATP citrate synthase. 1083 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATG
FLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDA
KAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYL
EINP
LVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSG
APSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGI
PIHVFGT
ETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI
VWGMQTRAVQGMLDFDYVCSRDEPSVAAM
VYPFTGDHKQKFYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEG
IPEALTRKLIKKA
DQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDH
VLRYQDTP
GVKMIVVLGEIGGTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALKEAGVFVPRSFDELGEIIQSV
YEDLVANGVIVPAQEVPPPTVPMDYSWAR
ELGLIRKPASFMTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADH
GPAVSGAHNTI
ICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFVNKMKKEGKLIMGIGHRVKSINNPDMRVQILKDYVRQHFPA
TPLLDYALEVEKITTSKKP
NLILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMS
M



DME EC Prediction for this protein is: 2.3.3.8
Check another protein