Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GRFLGKGGFA2.7.11.21;Polo kinase. 56
  • Domain: Protein kinase
  • Gene: PLK1
LGKGGFA2.7.11;Protein-serine/threonine kinases. 59
  • Domain: Protein kinase
VFAGKIV2.7.11.21;Polo kinase. 78
  • Binding Site K=Lysine at location 82 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
KPHQREK2.7.11.21;Polo kinase. 91
  • Domain: Protein kinase
VVLELCRRRSLLELHKRRKA2.7.11.21;Polo kinase. 128
  • Domain: Protein kinase
  • Gene: PLK1
TEPEARY2.7.11.21;Polo kinase. 149
  • Domain: Protein kinase
VIHRDLK2.7.11;Protein-serine/threonine kinases. 172
  • Active Site D=Aspartic acid at location 176 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HRDLKLGN2.7.11;Protein-serine/threonine kinases. 174
  • Active Site R=Arginine at location 175 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KLGNLFLN2.7.11.21;Polo kinase. 178
  • Domain: Protein kinase
CGTPNYIAPE2.7.11;Protein-serine/threonine kinases. 212
  • Domain: Protein kinase
YIAPEVL2.7.11;Protein-serine/threonine kinases. 217
  • Domain: Protein kinase
GHSFEVD2.7.11.21;Polo kinase. 227
  • Domain: Protein kinase
WSIGCIMYTLLVGKPPFETSCLKETY2.7.11.21;Polo kinase. 235
  • Domain: Protein kinase
  • Gene: PLK1
LVGKPPFE2.7.11;Protein-serine/threonine kinases. 245
  • Domain: Protein kinase
RIKKNEYS2.7.11.21;Polo kinase. 262
  • Domain: Protein kinase
  • Gene: PLK1
NEYSIPKHINPVA2.7.11.21;Polo kinase. 266
  • Domain: Protein kinase
  • Gene: PLK1
LLNDEFFT2.7.11.21;Polo kinase. 299
  • Domain: Protein kinase
  • Gene: PLK1
PPRFSIAPS2.7.11.21;Polo kinase. 322
  • Gene: PLK1
RQEEAEDPA2.7.11.21;Polo kinase. 396
  • Gene: PLK1
GYQLCDNSVGVLFND2.7.11.21;Polo kinase. 424
  • Domain: POLO box
ESYLTVSSHPNSL2.7.11.21;Polo kinase. 460
  • Domain: POLO box
  • Gene: PLK1
TPREGDELARLP2.7.11.21;Polo kinase. 498
  • Gene: PLK1
KELASRLRYAR2.7.11.21;Polo kinase. 574
  • Domain: POLO box
  • Gene: PLK1
MVDKLLSSRSA2.7.11.21;Polo kinase. 586
  • Gene: PLK1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSM
EISIHRSLAHQHVVGFHGFFEDNDFVF
VVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATK
VEYDGERKKTL
CGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
NDEFFT
SGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEA
EDPA
CIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPR
EGDELARLP
YLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
KAS



DME EC Prediction for this protein is: 2.7.11.21
Check another protein