Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NNFHSLYVKRHQ4.6.1.1;Adenylate cyclase. 265 -
ADIVGFT4.6.1.1;Adenylate cyclase. 283
  • Metal Site D=Aspartic acid at location 284 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
LNELFGKFD4.6.1.1;Adenylate cyclase. 304 -
RIKILGDCYYC4.6.1.1;Adenylate cyclase. 322
  • Metal Site D=Aspartic acid at location 328 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
ATGVDINMRVG4.6.1.1;Adenylate cyclase. 364 -
MRVGIHSG4.6.1.1;Adenylate cyclase. 371
  • Domain: Guanylate cyclase
GNVLCGV4.6.1.1;Adenylate cyclase. 378 -
WQYDVWS4.6.1.1;Adenylate cyclase. 390 -
TRYLESWGAA4.6.1.1;Adenylate cyclase. 485 -
LPAHVAAHF4.6.1.1;Adenylate cyclase. 853 -
ECLRLLNEII4.6.1.1;Adenylate cyclase. 903
  • Domain: Guanylate cyclase
EKIKTIG4.6.1.1;Adenylate cyclase. 928
  • Domain: Guanylate cyclase
AGVIGARKP4.6.1.1;Adenylate cyclase. 999
  • Domain: Guanylate cyclase
TVNVASR4.6.1.1;Adenylate cyclase. 1015
  • Domain: Guanylate cyclase
ASRMEST4.6.1;Lyases Phosphorus-oxygen lyases 1019
  • Domain: Guanylate cyclase
KIQVTEET4.6.1.1;Adenylate cyclase. 1030 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPSRHQAILGMAFLVLAVFAALSVLMYVECLLRRWLRALALLT
WACLVALGYVLVFDAWTKAACAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQLLANAVIFLCGNLTGAFHKHQ
MQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPD
NNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVV
LNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQVREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVS
LANRMEAAGVPGRVHITEATLKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRASVRM
TRYLESWGAARPFAHL
NHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRSEDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
SLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISERVETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVG
NETGLLAASSKTRALCEPLPYYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCCGQGLGNLTKPNGTTSGTPSCSWKDLKTMTN
FYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFETMENVNRLLLENV
LPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GL
ECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAHIGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAG
VIGARKP
QYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN



DME EC Prediction for this protein is: 4.6.1.1
Check another protein