Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PAPGPAQLR1.2.1.24;Succinate-semialdehyde dehydrogenase. 37
  • Gene: SSDH
DSFVGGRWLP1.2.1.24;Succinate-semialdehyde dehydrogenase. 62
  • Gene: SSDH
EARAAVRAAY1.2.1.24;Succinate-semialdehyde dehydrogenase. 97
  • Gene: SSDH
WREVSAKERSSLLRKWY1.2.1.24;Succinate-semialdehyde dehydrogenase. 112
  • Gene: SSDH
IITAESGKPLKEA1.2.1.24;Succinate-semialdehyde dehydrogenase. 141
  • Gene: SSDH
FLEWFSEEARR1.2.1.24;Succinate-semialdehyde dehydrogenase. 163
  • Gene: SSDH
ITPWNFP1.2.1;With NAD(+) or NADP(+) as acceptor. 201 -
ITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTP1.2.1.24;Succinate-semialdehyde dehydrogenase. 201
  • Gene: SSDH
AMITRKVG1.2.1;With NAD(+) or NADP(+) as acceptor. 209 -
GAALAAGCT1.2.1;With NAD(+) or NADP(+) as acceptor. 216 -
TPFSALALAELA1.2.1;With NAD(+) or NADP(+) as acceptor. 233 -
GVYNVIPCSR1.2.1.24;Succinate-semialdehyde dehydrogenase. 252
  • Gene: SSDH
CTDPLVSKISFTGST1.2.1.24;Succinate-semialdehyde dehydrogenase. 272
  • Gene: SSDH
TGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAV1.2.1.24;Succinate-semialdehyde dehydrogenase. 288
  • Active Site E=Glutamic acid at location 306 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Gene: SSDH
APFIVFD1.2.1;With NAD(+) or NADP(+) as acceptor. 311 -
ASKFRNTGQTCVCSN1.2.1.24;Succinate-semialdehyde dehydrogenase. 330
  • Active Site C=Cysteine at location 340 on the protein
  • Active Site Description: Nucleophile (By similarity).
  • Gene: SSDH
FLVQRGIHD1.2.1.24;Succinate-semialdehyde dehydrogenase. 346
  • Gene: SSDH
GTTQGPLIN1.2.1.24;Succinate-semialdehyde dehydrogenase. 377
  • Gene: SSDH
GPLINEK1.2.1;With NAD(+) or NADP(+) as acceptor. 381 -
VTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAP1.2.1.24;Succinate-semialdehyde dehydrogenase. 407
  • Gene: SSDH
AIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNE1.2.1.24;Succinate-semialdehyde dehydrogenase. 457
  • Gene: SSDH
VGVNEGLIS1.2.1.24;Succinate-semialdehyde dehydrogenase. 490
  • Gene: SSDH
KQSGLGR1.2.1;With NAD(+) or NADP(+) as acceptor. 508 -
SGLGREG1.2.1;With NAD(+) or NADP(+) as acceptor. 510 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLRTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARA
AVRAAY
EAFCRWREVSAKERSSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAV
ITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV
KRVSMELGGLAPFIVFDSANVDQAV
AGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAV
SKGATV
VTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSV
ECPFGGV
KQSGLGREGSKYGIDEYLELKYVCYGGL



DME EC Prediction for this protein is: 1.2.1.24
Check another protein