Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LRFRLQQLEALRRMVQEREK1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 20
  • Gene: AL3A2
LGEIDFML1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 65
  • Gene: AL3A2
IGAWNYP1.2.1;With NAD(+) or NADP(+) as acceptor. 108 -
LLPQYLDQDLY1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 150
  • Gene: AL3A2
ETTELLKQRFDHI1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 169
  • Gene: AL3A2
IVMEAAAK1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 192 -
VTLELGG1.2.1;With NAD(+) or NADP(+) as acceptor. 204
  • Active Site E=Glutamic acid at location 207 on the protein
  • Active Site Description: Proton acceptor (By similarity
TLELGGK1.2.1;With NAD(+) or NADP(+) as acceptor. 205
  • Active Site E=Glutamic acid at location 207 on the protein
  • Active Site Description: Proton acceptor (By similarity
CRRITWGKYMNCGQTCIAPDYILCEAS1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 226
  • Active Site C=Cysteine at location 241 on the protein
  • Active Site Description: By similarity.
  • Gene: AL3A2
APDYILC1.2.1;With NAD(+) or NADP(+) as acceptor. 243 -
SPDYERIINLRHFKR1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 276
  • Gene: AL3A2
GQKIAFGGE1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 297
  • Gene: AL3A2
EKPLALY1.2.1;With NAD(+) or NADP(+) as acceptor. 356 -
GMGAYHG1.2.1;With NAD(+) or NADP(+) as acceptor. 406 -
FSHQRPCLLK1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 419
  • Gene: AL3A2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQ
PLGVVLI
IGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKH
LTP
VTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGE
TDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG
GVGSS
GMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLVKAEYY



DME EC Prediction for this protein is: 1.2.1.3
Check another protein