Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FAESCKP2.7.11;Protein-serine/threonine kinases. 10 -
QEVSYTDTKVIGNGSFGVV2.7.11;Protein-serine/threonine kinases. 52 -
VAIKKVLQD2.7.11;Protein-serine/threonine kinases. 82
  • Binding Site K=Lysine at location 85 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
YFFYSSG2.7.11;Protein-serine/threonine kinases. 114
  • Domain: Protein kinase
YVPETVYRVARH2.7.11.26;[Tau protein] kinase. 134
  • Domain: Protein kinase
VPETVYR2.7.11;Protein-serine/threonine kinases. 135
  • Domain: Protein kinase
RAKQTLPV2.7.11.26;[Tau protein] kinase. 148
  • Domain: Protein kinase
HRDIKPQNLL2.7.11;Protein-serine/threonine kinases. 179
  • Active Site D=Aspartic acid at location 181 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
CDFGSAK2.7.11;Protein-serine/threonine kinases. 199
  • Domain: Protein kinase
DFGSAKQL2.7.11;Protein-serine/threonine kinases. 200
  • Domain: Protein kinase
SYICSRYYRAPEL2.7.11;Protein-serine/threonine kinases. 215
  • Domain: Protein kinase
YRAPELIFG2.7.11;Protein-serine/threonine kinases. 222
  • Domain: Protein kinase
ELLLGQP2.7.11;Protein-serine/threonine kinases. 249
  • Domain: Protein kinase
IFPGDSGVDQ2.7.11;Protein-serine/threonine kinases. 256
  • Domain: Protein kinase
DQLVEIIK2.7.11;Protein-serine/threonine kinases. 264
  • Domain: Protein kinase
IKVLGTPTRE2.7.11;Protein-serine/threonine kinases. 270
  • Domain: Protein kinase
MNPNYTEFKFPQIK2.7.11;Protein-serine/threonine kinases. 284
  • Domain: Protein kinase
FPQIKAHPW2.7.11;Protein-serine/threonine kinases. 293
  • Domain: Protein kinase
TPPEAIALCS2.7.11.26;[Tau protein] kinase. 309
  • Domain: Protein kinase
PLEACAHSFFDELR2.7.11.26;[Tau protein] kinase. 331
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI
MRKLDHCNIVRLR
YFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCD
FGSAKQL
VRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
W
TKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA
NTGDRGQTNNAASASASNST



DME EC Prediction for this protein is: 2.7.11.26
Check another protein