Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DQVFPYPSVL1.3.99;With other acceptors. 85
  • Gene: ACADV
RFFEEVND1.3.99;With other acceptors. 111
  • Gene: ACADV
QGLKELGAFGLQVP1.3.99;With other acceptors. 134
  • Gene: ACADV
AAFCLTEP1.3.99;With other acceptors. 212 -
IFTVFAKT1.3.99;With other acceptors. 258 -
ATGAVKEKITAFVVER1.3.99;With other acceptors. 271
  • Gene: ACADV
PEKKMGIKASNT1.3.99;With other acceptors. 296
  • Gene: ACADV
ENVLGEVG1.3.99;With other acceptors. 320 -
ILNNGRFGMAA1.3.99;With other acceptors. 336
  • Gene: ACADV
LQYVTESMAYM1.3.99;With other acceptors. 389
  • Gene: ACADV
SANMDQG1.3.99;With other acceptors. 401
  • Gene: ACADV
DFQIEAAISKIF1.3.99;With other acceptors. 410
  • Gene: ACADV
DECIQIMGGMGFMKEPGVERVLRD1.3.99;With other acceptors. 431
  • Gene: ACADV
NDILRLFVALQGCMDKGKEL1.3.99;With other acceptors. 465
  • Gene: ACADV
GEAGKQLRRR1.3.99;With other acceptors. 503
  • Gene: ACADV
QFATVVEAKL1.3.99;With other acceptors. 542
  • Gene: ACADV
NEQFLLQRLAD1.3.99;With other acceptors. 560
  • Gene: ACADV
VLSRASRS1.3.99;With other acceptors. 581 -
TAQHEKMLCD1.3.99;With other acceptors. 595
  • Gene: ACADV

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDALTRKKPAKAESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQ
FLKELVEPVS
RFFEEVNDPAKNDALEMVEETTWQGLKELGAFGLQVPSELGGVGLCNTQYARLVEIVGMHDLGVGITLGAHQSIGFKGILLFGTKAQKEK
YLPKLASGETV
AAFCLTEPSSGSDAASIRTSAVPSPCGKYYTLNGSKLWISNGGLADIFTVFAKTPVTDPATGAVKEKITAFVVERGFGGITHGPPEKKM
GIKASNT
AEVFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMV
SANMDQGATDFQIEAAISKIFGSEAAWKVTDECIQIMGGMGFMKEPGVERVLRDLRIFRIFEGTNDILRLFVALQGCMDKGKELSGLGSALKNPFGNAGL
LL
GEAGKQLRRRAGLGSGLSLSGLVHPELSRSGELAVRALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEK
MLCD
TWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVTSNPLGF



DME EC Prediction for this protein is: 1.3.99
Check another protein