Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NAGMNQFK6.1.1.7;Alanine--tRNA ligase. 43 -
CIRAGGKHNDL6.1.1.7;Alanine--tRNA ligase. 75 -
TFFEMLG6.1.1.7;Alanine--tRNA ligase. 96 -
SFGDYFK6.1.1.7;Alanine--tRNA ligase. 105 -
ERLYVTYFGGDEAAGLE6.1.1.7;Alanine--tRNA ligase. 131
  • Gene: SYAC
KDNFWEMG6.1.1.7;Alanine--tRNA ligase. 172 -
MGDTGPCGP6.1.1.7;Alanine--tRNA ligase. 178 -
DTGPCGPC6.1.1.7;Alanine--tRNA ligase. 180 -
GPCGPCSE6.1.1.7;Alanine--tRNA ligase. 182 -
EIWNLVF6.1.1.7;Alanine--tRNA ligase. 213 -
WNLVFIQY6.1.1.7;Alanine--tRNA ligase. 215 -
IDTGMGLER6.1.1.7;Alanine--tRNA ligase. 238 -
GLERLVS6.1.1;Ligases forming aminoacyl-tRNA and related compounds. 243 -
ERLVSVLQ6.1.1.7;Alanine--tRNA ligase. 245 -
SVLQNKMSNYDTD6.1.1.7;Alanine--tRNA ligase. 249 -
SNYDTDL6.1.1.7;Alanine--tRNA ligase. 256 -
NYDTDLF6.1.1.7;Alanine--tRNA ligase. 257 -
RTITVALADGGRPDNTGR6.1.1.7;Alanine--tRNA ligase. 303
  • Gene: SYAC
RGYVLRR6.1.1.7;Alanine--tRNA ligase. 320 -
LRRILRRA6.1.1.7;Alanine--tRNA ligase. 324 -
LRRAVRY6.1.1.7;Alanine--tRNA ligase. 328 -
LYDTYGF6.1.1.7;Alanine--tRNA ligase. 414 -
YDTYGFP6.1.1.7;Alanine--tRNA ligase. 415 -
KGLVVDMDGFEEER6.1.1.7;Alanine--tRNA ligase. 432
  • Gene: SYAC
LAQLKSQGKGAG6.1.1.7;Alanine--tRNA ligase. 447
  • Gene: SYAC
EDLIMLDIYAIEEL6.1.1.7;Alanine--tRNA ligase. 460
  • Gene: SYAC
TDDSPKYNY6.1.1.7;Alanine--tRNA ligase. 481 -
FYAEQGGQ6.1.1.7;Alanine--tRNA ligase. 534 -
GGYVLHIG6.1.1.7;Alanine--tRNA ligase. 570 -
THILNFAL6.1.1.7;Alanine--tRNA ligase. 608
  • Gene: SYAC
QKGSLVA6.1.1.7;Alanine--tRNA ligase. 624 -
PDRLRFD6.1.1.7;Alanine--tRNA ligase. 631 -
DRLRFDF6.1.1.7;Alanine--tRNA ligase. 632 -
YPDPVRVV6.1.1.7;Alanine--tRNA ligase. 690 -
VRVVSIG6.1.1.7;Alanine--tRNA ligase. 694 -
GTHLRNSS6.1.1.7;Alanine--tRNA ligase. 725 -
AVIPQWQ6.1.1.7;Alanine--tRNA ligase. 805 -
RETLKSLKKVMDDLDRASKADVQKRVLEKTKQ6.1.1.7;Alanine--tRNA ligase. 816
  • Gene: SYAC
IDSNPNQPLVILEMESGASAKALNEALKLFK6.1.1.7;Alanine--tRNA ligase. 849
  • Gene: SYAC

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEM
LG
SWSFGDYFKELACKMALELLTQEFGIPIERLYVTYFGGDEAAGLEADLECKQIWQNLGLDDTKILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDA
AHLVNQDDPNVL
EIWNLVFIQYNREADGILKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HA
RTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSL
GDSKTIPGDTAWL
LYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEVTDDSPKYNYHLDSSGSYVFE
NTVATVMALRREKMFVEEVSTGQECGVVLDKTC
FYAEQGGQIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRP
IMSNHTA
THILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIG
VPVSELLDDPSGPAGSLTSVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGE
ALAT
AVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKRVLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQLRLGDVKN



DME EC Prediction for this protein is: 6.1.1.7
Check another protein