Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FAGWSLPVQY2.1.2.10;Aminomethyltransferase. 52
  • Gene: GCST
LYVVSNAGC2.1.2.10;Aminomethyltransferase. 140
  • Gene: GCST
LLALQGP2.1.2.10;Aminomethyltransferase. 179
  • Gene: GCST
GYTGEDG2.1.2.10;Aminomethyltransferase. 224
  • Gene: GCST
ARDSLRLEAG2.1.2.10;Aminomethyltransferase. 260
  • Gene: GCST
PVEGSLSW2.1.2.10;Aminomethyltransferase. 283
  • Gene: GCST
WTLGKRRR2.1.2.10;Aminomethyltransferase. 290
  • Gene: GCST
KMPFVPT2.1.2.10;Aminomethyltransferase. 391
  • Gene: GCST

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMES
LVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGH
LYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLR
KLPFMTSAVMEVFGVSGCRVTRC
GYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM
DFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVS
KMPFVPTNYY
TLK



DME EC Prediction for this protein is: 2.1.2.10
Check another protein