Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DRALAEGVLLR6.3.2.3;Glutathione synthase. 24
  • Gene: GSHB
ALKQIEINT6.3.2.3;Glutathione synthase. 139
  • Gene: GSHB
ASFGGLASRTPAVH6.3.2.3;Glutathione synthase. 150
  • Gene: GSHB
KILSNNPSKGLA6.3.2.3;Glutathione synthase. 178
  • Gene: GSHB
VLLIAQEKERNIFDQRA6.3.2.3;Glutathione synthase. 206
  • Gene: GSHB
AVVYFRDGYMP6.3.2.3;Glutathione synthase. 262
  • Gene: GSHB
LPGQPEAVARLRATFAGLYSLD6.3.2.3;Glutathione synthase. 321
  • Gene: GSHB
KPQREGGGNN6.3.2.3;Glutathione synthase. 364
  • Gene: GSHB
NCLLRPGSPA6.3.2.3;Glutathione synthase. 408
  • Gene: GSHB
QCISELGIFGVYVR6.3.2.3;Glutathione synthase. 421
  • Gene: GSHB
TLVMNKHVGHLLRTKA6.3.2.3;Glutathione synthase. 438
  • Gene: GSHB
DGGVAAGVAVLDNPY6.3.2.3;Glutathione synthase. 458
  • Gene: GSHB

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSALLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFT
ARLFDIHKQVLKEGIAQTVFLGLNRSDYMFQRSADGSP
ALKQIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALGIAKAWELYG
SPNAL
VLLIAQEKERNIFDQRAIENELLARNIHVIRRTFEDISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQ
LAGTKKVQQELSRPGMLEML
LPGQPEAVARLRATFAGLYSLDVGEEGDQAIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEK
IEPEPFE
NCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV



DME EC Prediction for this protein is: 6.3.2.3
Check another protein