Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
IAPWNYP1.2.1;With NAD(+) or NADP(+) as acceptor. 30
  • Binding Site A=Alanine at location 31 on the protein
  • Binding site description: NAD; via carbonyl oxygen (By s
VVLKPSE1.2.1;With NAD(+) or NADP(+) as acceptor. 54 -
VTLELGG1.2.1;With NAD(+) or NADP(+) as acceptor. 126
  • Active Site E=Glutamic acid at location 129 on the protein
  • Active Site Description: Proton acceptor (By similarity
TLELGGK1.2.1;With NAD(+) or NADP(+) as acceptor. 127
  • Active Site E=Glutamic acid at location 129 on the protein
  • Active Site Description: Proton acceptor (By similarity
TLELGGKNPCYVDDNCDPQ1.2.1.5;Aldehyde dehydrogenase (NAD(P)(+)). 127
  • Active Site E=Glutamic acid at location 129 on the protein
  • Active Site Description: By similarity.
NAGQTCV1.2.1;With NAD(+) or NADP(+) as acceptor. 158
  • Active Site C=Cysteine at location 163 on the protein
  • Active Site Description: Nucleophile (By similarity).
GQTCVAPDY1.2.1;With NAD(+) or NADP(+) as acceptor. 160
  • Active Site C=Cysteine at location 163 on the protein
  • Active Site Description: By similarity.
EKPLALY1.2.1;With NAD(+) or NADP(+) as acceptor. 278 -
SGMGRYHGKF1.2.1.5;Aldehyde dehydrogenase (NAD(P)(+)). 327 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKL
DYIFFTGSPRVGKIVMTAATKHLTP
VTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPN
LGHIINQKQFQRLRALLGCSRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINRQ
EKPLALYAFSNSSQVVNQMLERT
SSGSFGGNEGFTYISLLSVPFGGVGH
SGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL



DME EC Prediction for this protein is: 1.2.1.5
Check another protein