Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TKIFINNEW1.2.1;With NAD(+) or NADP(+) as acceptor. 32 -
LADLVERD1.2.1;With NAD(+) or NADP(+) as acceptor. 103 -
RHEPIGV1.2.1;With NAD(+) or NADP(+) as acceptor. 167 -
ITPWNFP1.2.1;With NAD(+) or NADP(+) as acceptor. 177 -
PWNFPLLM1.2.1;With NAD(+) or NADP(+) as acceptor. 179 -
VLKPAEQTP1.2.1;With NAD(+) or NADP(+) as acceptor. 202 -
KPAEQTPL1.2.1;With NAD(+) or NADP(+) as acceptor. 204 -
EAGFPPGV1.2.1;With NAD(+) or NADP(+) as acceptor. 222 -
GVVNIVPG1.2.1;With NAD(+) or NADP(+) as acceptor. 228 -
VTLELGG1.2.1;With NAD(+) or NADP(+) as acceptor. 277
  • Active Site E=Glutamic acid at location 280 on the protein
  • Active Site Description: Proton acceptor (By similarity
TLELGGK1.2.1;With NAD(+) or NADP(+) as acceptor. 278
  • Active Site E=Glutamic acid at location 280 on the protein
  • Active Site Description: Proton acceptor (By similarity
FFNQGQCC1.2.1;With NAD(+) or NADP(+) as acceptor. 307 -
KILELIESGK1.2.1;With NAD(+) or NADP(+) as acceptor. 364 -
EGAKLECGG1.2.1;With NAD(+) or NADP(+) as acceptor. 375 -
MRIAKEEIFGPV1.2.1;With NAD(+) or NADP(+) as acceptor. 405 -
VFTKNLD1.2.1;With NAD(+) or NADP(+) as acceptor. 443 -
PFGGFKMSGNGRE1.2.1;With NAD(+) or NADP(+) as acceptor. 476 -
GNGRELGE1.2.1;With NAD(+) or NADP(+) as acceptor. 484 -
YTEVKTVT1.2.1;With NAD(+) or NADP(+) as acceptor. 497 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQICEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLL
HQ
LADLVERDRATLAALETMDTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNT
M
VLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGV
FFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSE
VTDN
MRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGFKMSGNGRELGEYALAEYTEV
KTVT
IKLGDKNP



DME EC Prediction for this protein is: 1.2.1
Check another protein