Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SKMEKSVIQGLFQQGLMGIE1.3.99;With other acceptors. 87
  • Gene: ACDSB
IEELAKVD1.3.99;With other acceptors. 125
  • Gene: ACDSB
GHGYKYAIGSLNEGRIGIAAQMLG1.3.99;With other acceptors. 280
  • Gene: ACDSB
AQGCFDYTIPYIKER1.3.99;With other acceptors. 305
  • Gene: ACDSB
FDFQGLQHQVA1.3.99;With other acceptors. 327
  • Gene: ACDSB
RLLTYNAAR1.3.99;With other acceptors. 347
  • Gene: ACDSB
KEASMAK1.3.99;With other acceptors. 365 -
TSKCIEWMGGVGYTK1.3.99;With other acceptors. 382
  • Gene: ACDSB
FRDAKIGTIYEG1.3.99;With other acceptors. 404
  • Active Site E=Glutamic acid at location 414 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Gene: ACDSB

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEGLAVRLLRGSRLLRRNFLTCLSSWKIPPHVSKSSQSEALLNITNNGIHFAPLQTFTDEEMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQ
GLMGIE
VDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAGAGSDSFALKTRADKEGDYYV
LNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRDTPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQI
GHGYKYAIGSLNEGRIGIAAQ
MLG
LAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPV
EKY
FRDAKIGTIYEGASNIQLNTIAKHIDAEY



DME EC Prediction for this protein is: 1.3.99
Check another protein