Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GAVNLISRFDRM1.5.1.20;Methylenetetrahydrofolate reductase (NAD(P)H). 72
  • Gene: MTHR
IASTAVNYCGLETILHMTCC1.5.1.20;Methylenetetrahydrofolate reductase (NAD(P)H). 112
  • Gene: MTHR
IKDVIEPIKDNDAAIRNYGIE1.5.1.20;Methylenetetrahydrofolate reductase (NAD(P)H). 280
  • Gene: MTHR
EDPRRPLPWALSAHPKRR1.5.1.20;Methylenetetrahydrofolate reductase (NAD(P)H). 341
  • Gene: MTHR
EDVRPIFWA1.5.1.20;Methylenetetrahydrofolate reductase (NAD(P)H). 360 -
DEFPNGR1.5.1.20;Methylenetetrahydrofolate reductase (NAD(P)H). 382 -
FPNGRWGNSSSPAFG1.5.1.20;Methylenetetrahydrofolate reductase (NAD(P)H). 384
  • Gene: MTHR
GILTINSQPNIN1.5.1.20;Methylenetetrahydrofolate reductase (NAD(P)H). 478
  • Gene: MTHR
NAVTWGIFPGREI1.5.1.20;Methylenetetrahydrofolate reductase (NAD(P)H). 557 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVNEARGNSSLNPCLEGSASSGSESSKDSSRCSTPGLDPERHERLREKMRRRLESGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLYIDVTWHPAGD
PGSDKETSSMM
IASTAVNYCGLETILHMTCCRQRLEEITGHLHKAKQLGLKNIMALRGDPIGDQWEEEEGGFNYAVDLVKHIRSEFGDYFDICVAGYPKG
HPEAGSFEADLKHLKEKVSAGADFIITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQGYHSLRQLVKLSKLEVPQE
IKDVIEPIKDNDAAIRNYGIE
LAVSLCQELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDPRRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGEL
KDYYLFYLKSKSPKEELLKMWGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQ
GILTINSQPNINGKPSSDPIVGW
GPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHLVNVKGENITNAPELQP
NAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIERWGKLYE
EESPSRTIIQYIHDNYFLVNLVDNDFPLDNCLWQVVEDTLELLNRPTQNARETEAP



DME EC Prediction for this protein is: 1.5.1.20
Check another protein