Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
AKRTPFG2.3.1.16;Acetyl-CoA C-acyltransferase. 12 -
YLARHVGLRVG2.3.1.16;Acetyl-CoA C-acyltransferase. 68
  • Gene: THIM
KGKQTMQVDEH2.3.1.16;Acetyl-CoA C-acyltransferase. 212
  • Gene: THIM
VTAGNAS2.3.1;Transferring groups other than amino-acyl groups. 245
  • Metal Site A=Alanine at location 247 on the protein
  • Metal Site Description: Potassium; via carbonyl oxygen
VIIASEDAVKKHNFTPLAR2.3.1.16;Acetyl-CoA C-acyltransferase. 260
  • Gene: THIM
VGYFVSGCDP2.3.1.16;Acetyl-CoA C-acyltransferase. 280
  • Gene: THIM
GIGPVPA2.3.1;Transferring groups other than amino-acyl groups. 293 -
VNEAFAPQ2.3.1.16;Acetyl-CoA C-acyltransferase. 319
  • Gene: THIM
GGAIALGHP2.3.1;Transferring groups other than amino-acyl groups. 345
  • Active Site H=Histidine at location 352 on the protein
  • Active Site Description: Proton acceptor (By similarity
CIGGGQGI2.3.1;Transferring groups other than amino-acyl groups. 382
  • Active Site C=Cysteine at location 382 on the protein
  • Active Site Description: Proton acceptor (By similarity

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIV
NGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFN
DEMAPIEVKTK
KGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAI
SGALKKAGLSLKDMDLVE
VNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA



DME EC Prediction for this protein is: 2.3.1.16
Check another protein