Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GYIPSNYVA2.7.10.2;Non-specific protein-tyrosine kinase. 98
  • Domain: SH3
FLIRESE2.7.10.2;Non-specific protein-tyrosine kinase. 140
  • Domain: SH2
WEIDRNSI2.7.10.2;Non-specific protein-tyrosine kinase. 227 -
GQFGEVW2.7.10.2;Non-specific protein-tyrosine kinase. 243
  • Domain: Protein kinase
PIYIITE2.7.10;Protein-tyrosine kinases. 301
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 353
  • Active Site D=Aspartic acid at location 354 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLV2.7.10;Protein-tyrosine kinases. 356
  • Domain: Protein kinase
KWTAPEA2.7.10.2;Non-specific protein-tyrosine kinase. 398
  • Domain: Protein kinase
IKSDVWSFGILL2.7.10.2;Non-specific protein-tyrosine kinase. 412
  • Domain: Protein kinase
KSDVWSFG2.7.10;Protein-tyrosine kinases. 413
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHLEKRRDGSSQQLQGYI
PSNYVA
EDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGL
CVKLGKPCLKIQVPAPFDLSYKTVDQ
WEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQLYAVCTLED
PIYIITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNYIHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWT
APEA
IRSNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRWKLEDYFETDSSYSDA
NNFIR



DME EC Prediction for this protein is: 2.7.10.2
Check another protein