Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LFVALYD2.7.10.2;Non-specific protein-tyrosine kinase. 111
  • Domain: SH3
NSLEKHSWYHGP2.7.10.2;Non-specific protein-tyrosine kinase. 166
  • Domain: SH3
INGSFLVRESESSPGQ2.7.10.2;Non-specific protein-tyrosine kinase. 191
  • Domain: SH2
ELVHHHS2.7.10.2;Non-specific protein-tyrosine kinase. 243
  • Domain: SH2
TTLHYPAPK2.7.10.2;Non-specific protein-tyrosine kinase. 257
  • Domain: SH2
KLGGGQYG2.7.10.2;Non-specific protein-tyrosine kinase. 293
  • Domain: Protein kinase
GVWKKYSLTVAVKT2.7.10.2;Non-specific protein-tyrosine kinase. 305
  • Binding Site K=Lysine at location 317 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
KEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCT2.7.10.2;Non-specific protein-tyrosine kinase. 320
  • Domain: Protein kinase
YGNLLDYLREC2.7.10.2;Non-specific protein-tyrosine kinase. 366
  • Domain: Protein kinase
LLYMATQI2.7.10.2;Non-specific protein-tyrosine kinase. 386
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 408
  • Active Site D=Aspartic acid at location 409 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KFPIKWTAPE2.7.10.2;Non-specific protein-tyrosine kinase. 446
  • Domain: Protein kinase
KSDVWAFGVLLWEIATYGM2.7.10.2;Non-specific protein-tyrosine kinase. 465
  • Domain: Protein kinase
KVYELMRACW2.7.10.2;Non-specific protein-tyrosine kinase. 513
  • Domain: Protein kinase
PADRPSF2.7.10;Protein-tyrosine kinases. 526
  • Domain: Protein kinase
HQAFETMF2.7.10.2;Non-specific protein-tyrosine kinase. 536
  • Domain: Protein kinase
RNKFAFREA2.7.10.2;Non-specific protein-tyrosine kinase. 1131 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVEDGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKEN
LLGATESDPN
LFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRES
ESSPGQ
LSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYL
EKKNFIH
RDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEK
GYRMEQPEGCPP
KVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
NSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADG
FSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMT
LPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLG
MAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICS
DPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSAL
TEPVPNSQLVDTGHQLLDYCSGYVDCIPQT
RNKFAFREAVSKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR



DME EC Prediction for this protein is: 2.7.10.2
Check another protein