Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KLSLMPWFHGKI2.7.10.2;Non-specific protein-tyrosine kinase. 116 -
RDLAARN2.7.10;Protein-tyrosine kinases. 351
  • Active Site D=Aspartic acid at location 352 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KWTAPEA2.7.10.2;Non-specific protein-tyrosine kinase. 389
  • Domain: Protein kinase
TSKSDVW2.7.10;Protein-tyrosine kinases. 402
  • Domain: Protein kinase
KSDVWSFG2.7.10;Protein-tyrosine kinases. 404
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLL
AAGALREREALSADP
KLSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDK
GAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGL
YIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVH
RDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGK
F
TSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGST
SPRSQEP



DME EC Prediction for this protein is: 2.7.10.2
Check another protein