Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SVDSKSI3.4.22.56;Caspase-3. 7
  • Gene: CASP3
SYKMDYPEMG3.4.22.56;Caspase-3. 36
  • Gene: CASP3
CIIINNKNF3.4.22;Cysteine endopeptidases. 47 -
CIIINNKNFHKSTGM3.4.22.56;Caspase-3. 47
  • Gene: CASP3
GTDVDAANLRETF3.4.22.56;Caspase-3. 66
  • Gene: CASP3
EDHSKRSSF3.4.22.56;Caspase-3. 106
  • Gene: CASP3
CVLLSHG3.4.22;Cysteine endopeptidases. 116
  • Active Site H=Histidine at location 121 on the protein
  • Active Site Description: By similarity.
IIQACRG3.4.22;Cysteine endopeptidases. 159
  • Active Site C=Cysteine at location 163 on the protein
  • Active Site Description: By similarity.
IQACRGTELD3.4.22;Cysteine endopeptidases. 160
  • Active Site C=Cysteine at location 163 on the protein
  • Active Site Description: By similarity.
IPVEADFLYAYST3.4.22.56;Caspase-3. 187
  • Gene: CASP3
PGYYSWR3.4.22;Cysteine endopeptidases. 201 -
GSWFIQSLC3.4.22;Cysteine endopeptidases. 212 -
GSWFIQSLCAMLK3.4.22.56;Caspase-3. 212
  • Gene: CASP3
MHILTRVNRKVA3.4.22.56;Caspase-3. 233
  • Gene: CASP3

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM
RDVSK
EDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA
PGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH



DME EC Prediction for this protein is: 3.4.22.56
Check another protein